Western Blot (WB)
(Western Blot analysis of SRD5A1 expression in transfected 293T cell line by SRD5A1 polyclonal antibody. Lane 1: SRD5A1 transfected lysate (29.5kD). Lane 2: Non-transfected lysate.)
Rabbit anti-Human SRD5A1 Polyclonal Antibody | anti-SRD5A1 antibody
SRD5A1 (3-oxo-5-alpha-steroid 4-dehydrogenase 1, SR Type 1, Steroid 5-alpha-reductase 1, S5AR 1) (PE)
Gene Names
SRD5A1; S5AR 1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SRD5A1; Polyclonal Antibody; SRD5A1 (3-oxo-5-alpha-steroid 4-dehydrogenase 1; SR Type 1; Steroid 5-alpha-reductase 1; S5AR 1) (PE); anti-SRD5A1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SRD5A1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-SRD5A1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human SRD5A1, aa1-259 (NP_001038.1).
Immunogen Sequence
MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of SRD5A1 expression in transfected 293T cell line by SRD5A1 polyclonal antibody. Lane 1: SRD5A1 transfected lysate (29.5kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of SRD5A1 expression in transfected 293T cell line by SRD5A1 polyclonal antibody. Lane 1: SRD5A1 transfected lysate (29.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-SRD5A1 antibody
Converts testosterone into 5-alpha-dihydrotestosterone and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology.
Product Categories/Family for anti-SRD5A1 antibody
References
1. Dihydrotestosterone synthesis bypasses testosterone to drive castration-resistant prostate cancer. Chang KH, Li R, Papari-Zareei M, Watumull L, Zhao YD, Auchus RJ, Sharifi N.Proc Natl Acad Sci U S A. 2011 Aug 16;108(33):13728-33. Epub 2011 Jul 27. 2. DHEA Administration Activates Local Bioactive Androgen Metabolism in Cancellous Site of Tibia of Ovariectomized Rats. Park JH, Aizawa K, Iemitsu M, Sato K, Akimoto T, Agata U, Maeda S, Ezawa I, Omi N.Calcif Tissue Int. 2011 Jun 8.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
29,459 Da
NCBI Official Full Name
3-oxo-5-alpha-steroid 4-dehydrogenase 1
NCBI Official Synonym Full Names
steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1)
NCBI Official Symbol
SRD5A1
NCBI Official Synonym Symbols
S5AR 1
NCBI Protein Information
3-oxo-5-alpha-steroid 4-dehydrogenase 1; SR type 1; 5-alpha reductase; steroid 5-alpha-reductase 1; steroid 5-alpha-reductase type I; 3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1
UniProt Protein Name
3-oxo-5-alpha-steroid 4-dehydrogenase 1
Protein Family
UniProt Gene Name
SRD5A1
UniProt Synonym Gene Names
S5AR 1
UniProt Entry Name
S5A1_HUMAN
NCBI Description
Steroid 5-alpha-reductase (EC 1.3.99.5) catalyzes the conversion of testosterone into the more potent androgen, dihydrotestosterone (DHT). Also see SRD5A2 (MIM 607306).[supplied by OMIM, Mar 2008]
Uniprot Description
SRD5A1: Converts testosterone into 5-alpha-dihydrotestosterone and progesterone or corticosterone into their corresponding 5- alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology. Belongs to the steroid 5-alpha reductase family.
Protein type: Lipid Metabolism - androgen and estrogen; Membrane protein, integral; Oxidoreductase; Membrane protein, multi-pass; EC 1.3.1.22
Chromosomal Location of Human Ortholog: 5p15
Cellular Component: endoplasmic reticulum membrane; integral to membrane
Molecular Function: electron carrier activity; cholestenone 5-alpha-reductase activity; 3-oxo-5-alpha-steroid 4-dehydrogenase activity
Biological Process: steroid metabolic process; sex determination; androgen biosynthetic process; cell differentiation; sex differentiation
Research Articles on SRD5A1
Similar Products
Product Notes
The SRD5A1 srd5a1 (Catalog #AAA6395069) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SRD5A1 (3-oxo-5-alpha-steroid 4-dehydrogenase 1, SR Type 1, Steroid 5-alpha-reductase 1, S5AR 1) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SRD5A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SRD5A1 srd5a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SRD5A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
