Western Blot (WB)
(Western Blot detection against Immunogen (37.22kD).)
Mouse anti-Human SCG5 Monoclonal Antibody | anti-SCG5 antibody
SCG5 (Neuroendocrine Protein 7B2, Pituitary Polypeptide, SGNE1 Secretogranin V, Secretogranin-5, Secretory Granule Endocrine Protein I)
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
SCG5; Monoclonal Antibody; SCG5 (Neuroendocrine Protein 7B2; Pituitary Polypeptide; SGNE1 Secretogranin V; Secretogranin-5; Secretory Granule Endocrine Protein I); Anti -SCG5 (Neuroendocrine Protein 7B2; anti-SCG5 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
8G11
Specificity
Recognizes human SCG5.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
EYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTDDGCLENTPDTAEFSREFQLHQHLFDPEHDYPGL*
Applicable Applications for anti-SCG5 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa59-160 from human SCG5 (NP_003011) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (37.22kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (37.22kD).)
Testing Data
(Detection limit for recombinant GST tagged SCG5 is 3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged SCG5 is 3ng/ml as a capture antibody.)
Related Product Information for anti-SCG5 antibody
SCG5 acts as a molecular chaperone for PCSK2/PC2, preventing its premature activation in the regulated secretory pathway. It binds to inactive PCSK2 in the endoplasmic reticulum and facilitates its transport from there to later compartments of the secretory pathway where it is proteolytically matured and activated. Also required for cleavage of PCSK2 but does not appear to be involved in its folding. It plays a role in regulating pituitary hormone secretion. The C-terminal peptide inhibits PCSK2 in vitro.
Product Categories/Family for anti-SCG5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
secretogranin V (7B2 protein)
NCBI Official Symbol
SCG5
NCBI Protein Information
secretogranin V (7B2 protein); secretogranin V (7B2 protein)
Protein Family
Similar Products
Product Notes
The SCG5 (Catalog #AAA646678) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SCG5 (Neuroendocrine Protein 7B2, Pituitary Polypeptide, SGNE1 Secretogranin V, Secretogranin-5, Secretory Granule Endocrine Protein I) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SCG5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the SCG5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EYPAHQAMNL VGPQSIEGGA HEGLQHLGPF GNIPNIVAEL TGDNIPKDFS EDQGYPDPPN PCPVGKTDDG CLENTPDTAE FSREFQLHQH LFDPEHDYPG L*. It is sometimes possible for the material contained within the vial of "SCG5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
