Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.22kD).)

Mouse anti-Human SCG5 Monoclonal Antibody | anti-SCG5 antibody

SCG5 (Neuroendocrine Protein 7B2, Pituitary Polypeptide, SGNE1 Secretogranin V, Secretogranin-5, Secretory Granule Endocrine Protein I) (HRP)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SCG5; Monoclonal Antibody; SCG5 (Neuroendocrine Protein 7B2; Pituitary Polypeptide; SGNE1 Secretogranin V; Secretogranin-5; Secretory Granule Endocrine Protein I) (HRP); anti-SCG5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
8G11
Specificity
Recognizes human SCG5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
211
Applicable Applications for anti-SCG5 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa59-160 from human SCG5 (NP_003011) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTDDGCLENTPDTAEFSREFQLHQHLFDPEHDYPGL*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.22kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.22kD).)

Testing Data

(Detection limit for recombinant GST tagged SCG5 is 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SCG5 is 3ng/ml as a capture antibody.)
Related Product Information for anti-SCG5 antibody
SCG5 acts as a molecular chaperone for PCSK2/PC2, preventing its premature activation in the regulated secretory pathway. It binds to inactive PCSK2 in the endoplasmic reticulum and facilitates its transport from there to later compartments of the secretory pathway where it is proteolytically matured and activated. Also required for cleavage of PCSK2 but does not appear to be involved in its folding. It plays a role in regulating pituitary hormone secretion. The C-terminal peptide inhibits PCSK2 in vitro.
Product Categories/Family for anti-SCG5 antibody
References
1. {alpha}-melanocyte-stimulating Hormone Inhibits TNF-{alpha}-stimulated MUC5AC Expression in Human Nasal Epithelial Cells. Lee SN, Ryu JH, Joo JH, Choi YH, Lee HJ, Kim YJ, Kim KB, Yoon JH.Am J Respir Cell Mol Biol. 2010 Jul 16.

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
neuroendocrine protein 7B2 isoform 2
UniProt Protein Name
Neuroendocrine protein 7B2
Protein Family
UniProt Gene Name
SCG5
UniProt Synonym Gene Names
SGNE1
UniProt Entry Name
7B2_HUMAN

Uniprot Description

7B2: Acts as a molecular chaperone for PCSK2/PC2, preventing its premature activation in the regulated secretory pathway. Binds to inactive PCSK2 in the endoplasmic reticulum and facilitates its transport from there to later compartments of the secretory pathway where it is proteolytically matured and activated. Also required for cleavage of PCSK2 but does not appear to be involved in its folding. Plays a role in regulating pituitary hormone secretion. The C-terminal peptide inhibits PCSK2 in vitro. Belongs to the 7B2 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide; Chaperone

Chromosomal Location of Human Ortholog: 15q13-q14

Cellular Component: extracellular region; secretory granule

Molecular Function: enzyme inhibitor activity; protein binding; GTP binding; unfolded protein binding

Biological Process: intracellular protein transport; neuropeptide signaling pathway; peptide hormone processing; negative regulation of catalytic activity; regulation of hormone secretion

Similar Products

Product Notes

The SCG5 scg5 (Catalog #AAA6154832) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SCG5 (Neuroendocrine Protein 7B2, Pituitary Polypeptide, SGNE1 Secretogranin V, Secretogranin-5, Secretory Granule Endocrine Protein I) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SCG5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SCG5 scg5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SCG5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.