Mouse SCAND2 Monoclonal Antibody | anti-SCAND2 antibody
SCAND2 (SCAN Domain Containing 2 Pseudogene) (MaxLight 550)
Gene Names
SCAND2P; SCAND2
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
SCAND2; Monoclonal Antibody; SCAND2 (SCAN Domain Containing 2 Pseudogene) (MaxLight 550); SCAN Domain Containing 2 Pseudogene; anti-SCAND2 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5F1
Specificity
Recognizes SCAND2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-SCAND2 antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SCAND2 (NP_071333, 1aa-62aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAVAVDQQIQTPSVQDLQIVKLEEDSHWEQEISLQGNYPGPETSCQSFWHFRYQEASRPREA
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-SCAND2 antibody
The SCAN domain is a highly conserved, leucine-rich motif of approximately 60 aa originally found within a subfamily of zinc finger proteins. This gene belongs to a family of genes that encode an isolated SCAN domain, but no zinc finger motif. Functional studies have established that the SCAN box is a protein interaction domain that mediates both hetero- and homoprotein associations, and maybe involved in regulation of transcriptional activity. Multiple transcript variants which encode the same isoform but differ only in their 3' UTRs, and another variant which encodes a distinct isoform have been described for this gene.
Product Categories/Family for anti-SCAND2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Synonym Full Names
SCAN domain containing 2 pseudogene
NCBI Official Symbol
SCAND2P
NCBI Official Synonym Symbols
SCAND2
UniProt Protein Name
Putative SCAN domain-containing protein SCAND2P
UniProt Gene Name
SCAND2P
UniProt Synonym Gene Names
SCAND2
UniProt Entry Name
SCND2_HUMAN
Similar Products
Product Notes
The SCAND2 scand2p (Catalog #AAA6219114) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SCAND2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SCAND2 scand2p for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SCAND2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
