Western Blot (WB)
(WB Suggested Anti-SCAND2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)
Rabbit anti-Horse, Human SCAND2 Polyclonal Antibody | anti-SCAND2P antibody
SCAND2 antibody - middle region
Gene Names
SCAND2P; SCAND2
Reactivity
Horse, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SCAND2; Polyclonal Antibody; SCAND2 antibody - middle region; anti-SCAND2P antibody
Host
Rabbit
Reactivity
Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IQQVEQLKQEVSRLARERDAYKVKCEKLANSGFREAGSTSDSPSSPEFFL
Sequence Length
152
Applicable Applications for anti-SCAND2P antibody
Western Blot (WB)
Homology
Horse: 100%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SCAND2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-SCAND2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)
Western Blot (WB)
(WB Suggested Anti-SCAND2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)
Related Product Information for anti-SCAND2P antibody
This is a rabbit polyclonal antibody against SCAND2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The SCAN domain is a highly conserved, leucine-rich motif of approximately 60 aa originally found within a subfamily of zinc finger proteins. Functional studies have established that the SCAN box is a protein interaction domain that mediates both hetero- and homoprotein associations, and maybe involved in regulation of transcriptional activity.
Target Description: The SCAN domain is a highly conserved, leucine-rich motif of approximately 60 aa originally found within a subfamily of zinc finger proteins. Functional studies have established that the SCAN box is a protein interaction domain that mediates both hetero- and homoprotein associations, and maybe involved in regulation of transcriptional activity.
Product Categories/Family for anti-SCAND2P antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
18kDa
NCBI Official Synonym Full Names
SCAN domain containing 2 pseudogene
NCBI Official Symbol
SCAND2P
NCBI Official Synonym Symbols
SCAND2
Protein Family
Similar Products
Product Notes
The SCAND2P (Catalog #AAA3213775) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SCAND2 antibody - middle region reacts with Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's SCAND2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SCAND2P for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IQQVEQLKQE VSRLARERDA YKVKCEKLAN SGFREAGSTS DSPSSPEFFL. It is sometimes possible for the material contained within the vial of "SCAND2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
