Western Blot (WB)
(Western Blot detection against Immunogen (38.21kD).)
Mouse anti-Human SC65 Monoclonal Antibody | anti-SC65 antibody
SC65 (LEPREL4, NOL55, SC65, Synaptonemal Complex Protein SC65, Leprecan-like Protein 4, Nucleolar Autoantigen No55) (PE)
Gene Names
P3H4; NO55; SC65; NOL55; LEPREL4
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SC65; Monoclonal Antibody; SC65 (LEPREL4; NOL55; Synaptonemal Complex Protein SC65; Leprecan-like Protein 4; Nucleolar Autoantigen No55) (PE); anti-SC65 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E12
Specificity
Recognizes human SC65.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
2352
Applicable Applications for anti-SC65 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa270-379 from SC65 (NP_006446) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QCKVDCEANLTPNVGGYFVDKFVATMYHYLQFAYYKLNDVRQAARSAASYMLFDPKDSVMQQNLVYYRFHRARWGLEEEDFQPREEAMLYHNQTAELRELLEFTHMYLQS
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (38.21kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (38.21kD).)
Related Product Information for anti-SC65 antibody
This nucleolar protein was first characterized because it was an autoantigen in cases on interstitial cystitis. The protein, with a predicted molecular weight of 50kD, appears to be localized in the particulate compartment of the interphase nucleolus, with a distribution distinct from that of nucleolar protein B23. During mitosis it is associated with chromosomes.
Product Categories/Family for anti-SC65 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens prolyl 3-hydroxylase family member 4 (inactive) (P3H4), mRNA
NCBI Official Synonym Full Names
prolyl 3-hydroxylase family member 4 (inactive)
NCBI Official Symbol
P3H4
NCBI Official Synonym Symbols
NO55; SC65; NOL55; LEPREL4
NCBI Protein Information
endoplasmic reticulum protein SC65
UniProt Protein Name
Synaptonemal complex protein SC65
UniProt Gene Name
LEPREL4
UniProt Synonym Gene Names
NOL55; SC65
UniProt Entry Name
SC65_HUMAN
NCBI Description
This nucleolar protein was first characterized because it was an autoantigen in cases on interstitial cystitis. The protein, with a predicted molecular weight of 50 kDa, appears to be localized in the particulate compartment of the interphase nucleolus, with a distribution distinct from that of nucleolar protein B23. During mitosis it is associated with chromosomes. [provided by RefSeq, Jul 2008]
Research Articles on SC65
Similar Products
Product Notes
The SC65 leprel4 (Catalog #AAA6160126) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SC65 (LEPREL4, NOL55, SC65, Synaptonemal Complex Protein SC65, Leprecan-like Protein 4, Nucleolar Autoantigen No55) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SC65 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SC65 leprel4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SC65, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
