Mouse anti-Human NDUFS3 Monoclonal Antibody | anti-NDUFS3 antibody

NDUFS3 (NADH Dehydrogenase [Ubiquinone] Iron-sulfur Protein 3, Mitochondrial, Complex I-30kD, CI-30kD, NADH-ubiquinone Oxidoreductase 30kD Subunit) (HRP)

Cat. Num. AAA6153735

• Gene Names: NDUFS3; CI-30
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NDUFS3; Monoclonal Antibody; NDUFS3 (NADH Dehydrogenase [Ubiquinone] Iron-sulfur Protein 3; Mitochondrial; Complex I-30kD; CI-30kD; NADH-ubiquinone Oxidoreductase 30kD Subunit) (HRP); anti-NDUFS3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1D6
• Specificity: Recognizes human NDUFS3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-NDUFS3 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-264 from human NDUFS3 (AAH00617) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAAAAVARLWWRGILGASALTRGTGRPSVLLLPVRRESAGADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (54.56kD).)

Western Blot (WB)

(Western Blot analysis of NDUFS3 expression in transfected 293T cell line by NDUFS3 monoclonal antibody. Lane 1: NDUFS3 transfected lysate (30.2kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to NDUFS3 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of NDUFS3 transfected lysate using anti-NDUFS3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NDUFS3 rabbit polyclonal antibody.)

Western Blot (WB)

(Western blot analysis of NDUFS3 over-expressed 293 cell line, cotransfected with NDUFS3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with NDUFS3 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Product Categories/Family for anti-NDUFS3 antibody

Antibodies; Enzymes; Dehydrogenase

NCBI and Uniprot Product Information

• NCBI GI #: 37588978
• NCBI GeneID: 4722
• Molecular Weight: 14,679 Da
• NCBI Official Full Name: Homo sapiens NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30kDa (NADH-coenzyme Q reductase), mRNA
• NCBI Official Synonym Full Names: NADH:ubiquinone oxidoreductase core subunit S3
• NCBI Official Symbol: NDUFS3
• NCBI Official Synonym Symbols: CI-30
• NCBI Protein Information: NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial

NCBI Description

This gene encodes one of the iron-sulfur protein (IP) components of mitochondrial NADH:ubiquinone oxidoreductase (complex I). Mutations in this gene are associated with Leigh syndrome resulting from mitochondrial complex I deficiency.[provided by RefSeq, Apr 2009]