Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.36kD) using.)

Mouse anti-Human S100A1 Monoclonal Antibody | anti-S100A1 antibody

S100A1 (S100 Calcium-binding Protein A1, Protein S100-A1, S-100 Protein alpha Chain, S-100 Protein Subunit alpha, S100 Calcium-binding Protein A1, S100A) (AP)

Gene Names
S100A1; S100; S100A; S100-alpha
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
S100A1; Monoclonal Antibody; S100A1 (S100 Calcium-binding Protein A1; Protein S100-A1; S-100 Protein alpha Chain; S-100 Protein Subunit alpha; S100 Calcium-binding Protein A1; S100A) (AP); anti-S100A1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D5
Specificity
Recognizes human S100A1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
94
Applicable Applications for anti-S100A1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa-1-75 from human S100A1 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEY*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.36kD) using.)

Western Blot (WB) (Western Blot detection against Immunogen (34.36kD) using.)

Western Blot (WB)

(Western Blot analysis of S100A1 expression in transfected 293T cell line using. Lane 1: S100A1 transfected lysate (10.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of S100A1 expression in transfected 293T cell line using. Lane 1: S100A1 transfected lysate (10.5kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-S100A1 antibody
Protein S100-A1 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. Protein S100-A1 exists as a dimer of either two alpha chains, two beta chains or one alpha and one beta chain. It weakly binds calcium but binds zinc very tightly and distinct binding sites with different affinities exist for both ions on each monomer. This protein is highly prevalent in heart and to a lesser extent in skeletal muscle and brain.
Product Categories/Family for anti-S100A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
protein S100-A1
NCBI Official Synonym Full Names
S100 calcium binding protein A1
NCBI Official Symbol
S100A1
NCBI Official Synonym Symbols
S100; S100A; S100-alpha
NCBI Protein Information
protein S100-A1
UniProt Protein Name
Protein S100-A1
Protein Family
UniProt Gene Name
S100A1
UniProt Synonym Gene Names
S100A
UniProt Entry Name
S10A1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-induced Ca2+ release, inhibition of microtubule assembly, and inhibition of protein kinase C-mediated phosphorylation. Reduced expression of this protein has been implicated in cardiomyopathies. [provided by RefSeq, Jul 2008]

Uniprot Description

S100A1: Weakly binds calcium but binds zinc very tightly- distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. Dimer of either two alpha chains, or two beta chains, or one alpha and one beta chain. Interacts with AGER and CAPZA1. Interacts with FKBP4. Interacts with RYR1 and RYR2. Highly prevalent in heart. Also found in lesser quantities in skeletal muscle and brain. Belongs to the S-100 family.

Protein type: Calcium-binding; Endoplasmic reticulum

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: neuron projection; protein complex; sarcoplasmic reticulum; M band; Z disc; nucleus

Molecular Function: identical protein binding; protein binding; protein homodimerization activity; calcium ion binding; calcium-dependent protein binding; ATPase binding

Biological Process: substantia nigra development; negative regulation of transcription from RNA polymerase II promoter; regulation of heart contraction

Research Articles on S100A1

Similar Products

Product Notes

The S100A1 s100a1 (Catalog #AAA6133581) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The S100A1 (S100 Calcium-binding Protein A1, Protein S100-A1, S-100 Protein alpha Chain, S-100 Protein Subunit alpha, S100 Calcium-binding Protein A1, S100A) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's S100A1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the S100A1 s100a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "S100A1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.