Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to RUNX1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.2 ug/ml])

Mouse RUNX1 Monoclonal Antibody | anti-RUNX1 antibody

RUNX1 (Runt-Related Transcription Factor 1, AML1, AML1-EVI-1, AMLCR1, CBFA2, EVI-1, PEBP2aB) (AP)

Gene Names
RUNX1; AML1; CBFA2; EVI-1; AMLCR1; PEBP2aB; AML1-EVI-1
Applications
ELISA, Immunohistochemistry
Purity
Purified
Synonyms
RUNX1; Monoclonal Antibody; RUNX1 (Runt-Related Transcription Factor 1; AML1; AML1-EVI-1; AMLCR1; CBFA2; EVI-1; PEBP2aB) (AP); Runt-Related Transcription Factor 1; PEBP2aB; anti-RUNX1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3A8
Specificity
Recognizes RUNX1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-RUNX1 antibody
ELISA (EIA), Immunohistochemistry (IHC)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
RUNX1 (NP_001001890.1, 210aa-310aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFP
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to RUNX1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.2 ug/ml])

Testing Data (Immunoperoxidase of monoclonal antibody to RUNX1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.2 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to RUNX1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.2 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to RUNX1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.2 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RUNX1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to RUNX1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RUNX1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to RUNX1 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-RUNX1 antibody
Core binding factor (CBF) is a heterodimeric transcription factor that binds to the core element of many enhancers and promoters. The protein encoded by this gene represents the alpha subunit of CBF and is thought to be involved in the development of normal hematopoiesis. Chromosomal translocations involving this gene are well-documented and have been associated with several types of leukemia. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Product Categories/Family for anti-RUNX1 antibody
References
1. The RUNX1 transcription factor is expressed in serous epithelial ovarian carcinoma and contributes to cell proliferation, migration and invasion. Keita M, Bachvarova M, Morin C, Plante M, Gregoire J, Renaud MC, Sebastianelli A, Trinh XB, Bachvarov DCell Cycle. 2013 Feb 26;12(6).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
861
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48,737 Da
NCBI Official Full Name
runt-related transcription factor 1 isoform AML1b
NCBI Official Synonym Full Names
runt-related transcription factor 1
NCBI Official Symbol
RUNX1
NCBI Official Synonym Symbols
AML1; CBFA2; EVI-1; AMLCR1; PEBP2aB; AML1-EVI-1
NCBI Protein Information
runt-related transcription factor 1; CBF-alpha-2; PEA2-alpha B; PEBP2-alpha B; oncogene AML-1; AML1-EVI-1 fusion protein; acute myeloid leukemia 1 protein; SL3-3 enhancer factor 1 alpha B subunit; SL3/AKV core-binding factor alpha B subunit; core-binding
UniProt Protein Name
Runt-related transcription factor 1
UniProt Gene Name
RUNX1
UniProt Synonym Gene Names
AML1; CBFA2; CBF-alpha-2; PEA2-alpha B
UniProt Entry Name
RUNX1_HUMAN

NCBI Description

Core binding factor (CBF) is a heterodimeric transcription factor that binds to the core element of many enhancers and promoters. The protein encoded by this gene represents the alpha subunit of CBF and is thought to be involved in the development of normal hematopoiesis. Chromosomal translocations involving this gene are well-documented and have been associated with several types of leukemia. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

AML1: CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL-3 and GM-CSF promoters. The alpha subunit binds DNA and appears to have a role in the development of normal hematopoiesis. Isoform AML-1L interferes with the transactivation activity of RUNX1. Acts synergistically with ELF4 to transactivate the IL-3 promoter and with ELF2 to transactivate the mouse BLK promoter. Inhibits KAT6B- dependent transcriptional activation. Heterodimer with CBFB. RUNX1 binds DNA as a monomer and through the Runt domain. DNA-binding is increased by heterodimerization. Isoform AML-1L can neither bind DNA nor heterodimerize. Interacts with TLE1 and ALYREF/THOC4. Interacts with ELF1, ELF2 and SPI1. Interacts via its Runt domain with the ELF4 N-terminal region. Interaction with ELF2 isoform 2 (NERF-1a) may act to repress RUNX1-mediated transactivation. Interacts with KAT6A and KAT6B. Interacts with SUV39H1, leading to abrogation of transactivating and DNA-binding properties of RUNX1. Interacts with YAP1. Interacts with HIPK2. Interaction with CDK6 prevents myeloid differentiation, reducing its transcription transactivation activity. Expressed in all tissues examined except brain and heart. Highest levels in thymus, bone marrow and peripheral blood. 11 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Oncoprotein; Transcription factor

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; cytoplasm; basement membrane; nucleus

Molecular Function: protein binding; protein homodimerization activity; DNA binding; protein heterodimerization activity; calcium ion binding; transcription factor binding; transcription factor activity; ATP binding

Biological Process: central nervous system development; hair follicle morphogenesis; transcription, DNA-dependent; embryonic hemopoiesis; in utero embryonic development; positive regulation of transcription, DNA-dependent; positive regulation of granulocyte differentiation; regulation of signal transduction; liver development; negative regulation of granulocyte differentiation; peripheral nervous system neuron development; behavioral response to pain; positive regulation of angiogenesis; myeloid progenitor cell differentiation; positive regulation of interleukin-2 production; positive regulation of transcription from RNA polymerase II promoter; hemopoiesis; myeloid cell differentiation; skeletal development

Disease: Platelet Disorder, Familial, With Associated Myeloid Malignancy; Leukemia, Acute Myeloid; Rheumatoid Arthritis

Research Articles on RUNX1

Similar Products

Product Notes

The RUNX1 runx1 (Catalog #AAA6163084) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's RUNX1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RUNX1 runx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RUNX1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.