Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human RUFY1 Monoclonal Antibody | anti-RUFY1 antibody

RUFY1 (RUN and FYVE Domain-containing Protein 1, FYVE-finger Protein EIP1, La-binding Protein 1, Rab4-interacting Protein, RABIP4, Zinc Finger FYVE Domain-containing Protein 12, ZFYVE12) (HRP)

Gene Names
RUFY1; RABIP4; ZFYVE12
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RUFY1; Monoclonal Antibody; RUFY1 (RUN and FYVE Domain-containing Protein 1; FYVE-finger Protein EIP1; La-binding Protein 1; Rab4-interacting Protein; RABIP4; Zinc Finger FYVE Domain-containing Protein 12; ZFYVE12) (HRP); anti-RUFY1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3A5
Specificity
Recognizes human RUFY1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
708
Applicable Applications for anti-RUFY1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa376-475 from human RUFY1 (NP_079434) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ITSFEGKTNQVMSSMKQMEERLQHSERARQGAEERSHKLQQELGGRIGALQLQLSQLHEQCSSLEKELKSEKEQRQALQRELQHEKDTSSLLRMELQQV
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(RUFY1 monoclonal antibody, Western Blot analysis of RUFY1 expression in HeLa.)

Western Blot (WB) (RUFY1 monoclonal antibody, Western Blot analysis of RUFY1 expression in HeLa.)
Product Categories/Family for anti-RUFY1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
RUN and FYVE domain-containing protein 1 isoform a
NCBI Official Synonym Full Names
RUN and FYVE domain containing 1
NCBI Official Symbol
RUFY1
NCBI Official Synonym Symbols
RABIP4; ZFYVE12
NCBI Protein Information
RUN and FYVE domain-containing protein 1
UniProt Protein Name
RUN and FYVE domain-containing protein 1
UniProt Gene Name
RUFY1
UniProt Synonym Gene Names
RABIP4; ZFYVE12
UniProt Entry Name
RUFY1_HUMAN

NCBI Description

This gene encodes a protein that contains a RUN domain and a FYVE-type zinc finger domain. The encoded protein binds to phosphatidylinositol-3-phosphate (PI3P) and plays a role in early endosomal trafficking, tethering and fusion through interactions with small GTPases including Rab4, Rab5 and Rab14. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

RUFY1: Binds phospholipid vesicles containing phosphatidylinositol 3-phosphate and participates in early endosomal trafficking. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 5q35.3

Cellular Component: intracellular membrane-bound organelle; early endosome membrane; cytoplasm; nucleus

Molecular Function: protein binding; zinc ion binding; lipid binding; protein transporter activity

Biological Process: protein transport; regulation of endocytosis; endocytosis

Research Articles on RUFY1

Similar Products

Product Notes

The RUFY1 rufy1 (Catalog #AAA6154781) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RUFY1 (RUN and FYVE Domain-containing Protein 1, FYVE-finger Protein EIP1, La-binding Protein 1, Rab4-interacting Protein, RABIP4, Zinc Finger FYVE Domain-containing Protein 12, ZFYVE12) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RUFY1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RUFY1 rufy1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RUFY1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.