Mouse anti-Human RUFY1 Monoclonal Antibody | anti-RUFY1 antibody

RUFY1 (RUN and FYVE Domain-containing Protein 1, FYVE-finger Protein EIP1, La-binding Protein 1, Rab4-interacting Protein, RABIP4, Zinc Finger FYVE Domain-containing Protein 12, ZFYVE12) APC

Cat. Num. AAA6138872

• Gene Names: RUFY1; RABIP4; ZFYVE12
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RUFY1; Monoclonal Antibody; RUFY1 (RUN and FYVE Domain-containing Protein 1; FYVE-finger Protein EIP1; La-binding Protein 1; Rab4-interacting Protein; RABIP4; Zinc Finger FYVE Domain-containing Protein 12; ZFYVE12) APC; anti-RUFY1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3A5
• Specificity: Recognizes human RUFY1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 708

• Applicable Applications for anti-RUFY1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa376-475 from human RUFY1 (NP_079434) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ITSFEGKTNQVMSSMKQMEERLQHSERARQGAEERSHKLQQELGGRIGALQLQLSQLHEQCSSLEKELKSEKEQRQALQRELQHEKDTSSLLRMELQQV
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(RUFY1 monoclonal antibody, Western Blot analysis of RUFY1 expression in HeLa.)

Product Categories/Family for anti-RUFY1 antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 94721336
• NCBI GeneID: 80230
• NCBI Accession #: NP_079434
• NCBI GenBank Nucleotide #: NM_025158
• UniProt Accession #: Q96T51
• NCBI Official Full Name: RUN and FYVE domain-containing protein 1 isoform a
• NCBI Official Synonym Full Names: RUN and FYVE domain containing 1
• NCBI Official Symbol: RUFY1
• NCBI Official Synonym Symbols: RABIP4; ZFYVE12
• NCBI Protein Information: RUN and FYVE domain-containing protein 1
• UniProt Protein Name: RUN and FYVE domain-containing protein 1
• Protein Family: RUN and FYVE domain-containing protein
• UniProt Gene Name: RUFY1
• UniProt Synonym Gene Names: RABIP4; ZFYVE12
• UniProt Entry Name: RUFY1_HUMAN

NCBI Description

This gene encodes a protein that contains a RUN domain and a FYVE-type zinc finger domain. The encoded protein binds to phosphatidylinositol-3-phosphate (PI3P) and plays a role in early endosomal trafficking, tethering and fusion through interactions with small GTPases including Rab4, Rab5 and Rab14. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

RUFY1: Binds phospholipid vesicles containing phosphatidylinositol 3-phosphate and participates in early endosomal trafficking. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 5q35.3

Cellular Component: intracellular membrane-bound organelle; early endosome membrane; cytoplasm; nucleus

Molecular Function: protein binding; zinc ion binding; lipid binding; protein transporter activity

Biological Process: protein transport; regulation of endocytosis; endocytosis