Mouse anti-Human RSK1 Monoclonal Antibody | anti-RSK1 antibody

RSK1 (Ribosomal S6 Kinase 1, RSK-1, 90kD Ribosomal Protein S6 Kinase 1, p90-RSK 1, p90RSK1, p90S6K, MAP Kinase-activated Protein Kinase 1a, MAPK-activated Protein Kinase 1a, MAPKAP Kinase 1a, MAPKAPK1A, MAPKAPK-1a, Ribosomal Protein S6 Kinase alpha-1, RPS

Cat. Num. AAA6144166

• Gene Names: RPS6KA1; RSK; HU-1; RSK1; p90Rsk; MAPKAPK1A
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RSK1; Monoclonal Antibody; RSK1 (Ribosomal S6 Kinase 1; RSK-1; 90kD Ribosomal Protein S6 Kinase 1; p90-RSK 1; p90RSK1; p90S6K; MAP Kinase-activated Protein Kinase 1a; MAPK-activated Protein Kinase 1a; MAPKAP Kinase 1a; MAPKAPK1A; MAPKAPK-1a; Ribosomal Protein S6 Kinase alpha-1; RPS; anti-RSK1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4E11
• Specificity: Recognizes human RPS6KA1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-RSK1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-736 from human RPS6KA1 (AAH14966) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MPLAQLKEPWPLMELVPLDPENGQTSGEEAGLQPSKDEGVLKEISITHHVKAGSEKADPSHFELLKVLGQGSFGKVFLVRKVTRPDSGHLYAMKVLKKATLKVRDRVRTKMERDILADVNHPFVVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALGLDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKEAIDHEKKAYSFCGTVEYMAPEVVNRQGHSHSADWWSYGVLMFEM
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(RPS6KA1 monoclonal antibody. Western Blot analysis of RPS6KA1 expression in K-562.)

Testing Data

(Detection limit for recombinant GST tagged RPS6KA1 is 1ng/ml as a capture antibody.)

Related Product Information for anti-RSK1 antibody

RSK1 is an RSK serine/threonine kinase. This kinase contains 2 nonidentical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Product Categories/Family for anti-RSK1 antibody

Antibodies; Protein Kinases; Ribosomal

NCBI and Uniprot Product Information

• NCBI GI #: 15929012
• NCBI GeneID: 6195
• Molecular Weight: 81,147 Da
• NCBI Official Full Name: Homo sapiens ribosomal protein S6 kinase, 90kDa, polypeptide 1, mRNA
• NCBI Official Synonym Full Names: ribosomal protein S6 kinase A1
• NCBI Official Symbol: RPS6KA1
• NCBI Official Synonym Symbols: RSK; HU-1; RSK1; p90Rsk; MAPKAPK1A
• NCBI Protein Information: ribosomal protein S6 kinase alpha-1

NCBI Description

This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 nonidentical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]