Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (RPS6KA1 monoclonal antibody. Western Blot analysis of RPS6KA1 expression in K-562.)

Mouse anti-Human RSK1 Monoclonal Antibody | anti-RSK1 antibody

RSK1 (Ribosomal S6 Kinase 1, RSK-1, 90kD Ribosomal Protein S6 Kinase 1, p90-RSK 1, p90RSK1, p90S6K, MAP Kinase-activated Protein Kinase 1a, MAPK-activated Protein Kinase 1a, MAPKAP Kinase 1a, MAPKAPK1A, MAPKAPK-1a, Ribosomal Protein S6 Kinase alpha-1, RPS

Gene Names
RPS6KA1; RSK; HU-1; RSK1; p90Rsk; MAPKAPK1A
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RSK1; Monoclonal Antibody; RSK1 (Ribosomal S6 Kinase 1; RSK-1; 90kD Ribosomal Protein S6 Kinase 1; p90-RSK 1; p90RSK1; p90S6K; MAP Kinase-activated Protein Kinase 1a; MAPK-activated Protein Kinase 1a; MAPKAP Kinase 1a; MAPKAPK1A; MAPKAPK-1a; Ribosomal Protein S6 Kinase alpha-1; RPS; anti-RSK1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4E11
Specificity
Recognizes human RPS6KA1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-RSK1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-736 from human RPS6KA1 (AAH14966) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPLAQLKEPWPLMELVPLDPENGQTSGEEAGLQPSKDEGVLKEISITHHVKAGSEKADPSHFELLKVLGQGSFGKVFLVRKVTRPDSGHLYAMKVLKKATLKVRDRVRTKMERDILADVNHPFVVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALGLDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKEAIDHEKKAYSFCGTVEYMAPEVVNRQGHSHSADWWSYGVLMFEM
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(RPS6KA1 monoclonal antibody. Western Blot analysis of RPS6KA1 expression in K-562.)

Western Blot (WB) (RPS6KA1 monoclonal antibody. Western Blot analysis of RPS6KA1 expression in K-562.)

Testing Data

(Detection limit for recombinant GST tagged RPS6KA1 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RPS6KA1 is 1ng/ml as a capture antibody.)
Related Product Information for anti-RSK1 antibody
RSK1 is an RSK serine/threonine kinase. This kinase contains 2 nonidentical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Product Categories/Family for anti-RSK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
81,147 Da
NCBI Official Full Name
Homo sapiens ribosomal protein S6 kinase, 90kDa, polypeptide 1, mRNA
NCBI Official Synonym Full Names
ribosomal protein S6 kinase A1
NCBI Official Symbol
RPS6KA1
NCBI Official Synonym Symbols
RSK; HU-1; RSK1; p90Rsk; MAPKAPK1A
NCBI Protein Information
ribosomal protein S6 kinase alpha-1

NCBI Description

This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 nonidentical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

Research Articles on RSK1

Similar Products

Product Notes

The RSK1 (Catalog #AAA6133560) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RSK1 (Ribosomal S6 Kinase 1, RSK-1, 90kD Ribosomal Protein S6 Kinase 1, p90-RSK 1, p90RSK1, p90S6K, MAP Kinase-activated Protein Kinase 1a, MAPK-activated Protein Kinase 1a, MAPKAP Kinase 1a, MAPKAPK1A, MAPKAPK-1a, Ribosomal Protein S6 Kinase alpha-1, RPS reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RSK1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RSK1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RSK1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.