Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to RSC1A1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1.2ug/ml])

Mouse anti-Human RSC1A1 Monoclonal Antibody | anti-RSC1A1 antibody

RSC1A1 (Regulatory Solute Carrier Protein Family 1 Member 1, Transporter Regulator RS1, hRS1) APC

Gene Names
RSC1A1; RS1
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RSC1A1; Monoclonal Antibody; RSC1A1 (Regulatory Solute Carrier Protein Family 1 Member 1; Transporter Regulator RS1; hRS1) APC; anti-RSC1A1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6F9
Specificity
Recognizes human RSC1A1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
617
Applicable Applications for anti-RSC1A1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1.2ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-101 from human RSC1A1 (NP_006502) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSSLPTSDGFNHPARSSGQSPDVGNPMSLARSVSASVCPIKPSDSDRIEPKAVKALKASAEFQLNSEKKEHLSLQDLSDHASSADHAPTDQSPAMPMQNS
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to RSC1A1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1.2ug/ml])

Testing Data (Immunoperoxidase of monoclonal antibody to RSC1A1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1.2ug/ml])
Product Categories/Family for anti-RSC1A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
regulatory solute carrier protein family 1 member 1
NCBI Official Synonym Full Names
regulator of solute carriers 1
NCBI Official Symbol
RSC1A1
NCBI Official Synonym Symbols
RS1
NCBI Protein Information
regulatory solute carrier protein family 1 member 1
UniProt Protein Name
Regulatory solute carrier protein family 1 member 1
UniProt Gene Name
RSC1A1
UniProt Synonym Gene Names
hRS1
UniProt Entry Name
RSCA1_HUMAN

NCBI Description

The protein encoded by this intronless gene inhibits the expression of the solute carrier family 5 (sodium/glucose cotransporter), member 1 gene (SLC5A1) and downregulates exocytosis of the SLC5A1 protein. The encoded protein is sometimes found coating the trans-Golgi network and other times is localized to the nucleus, depending on the cell cycle stage. This protein also inhibits the expression of solute carrier family 22 (organic cation transporter), member 2 (SLC22A2). [provided by RefSeq, Dec 2015]

Research Articles on RSC1A1

Similar Products

Product Notes

The RSC1A1 rsc1a1 (Catalog #AAA6138860) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RSC1A1 (Regulatory Solute Carrier Protein Family 1 Member 1, Transporter Regulator RS1, hRS1) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RSC1A1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1.2ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RSC1A1 rsc1a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RSC1A1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.