Mouse anti-Human RSC1A1 Monoclonal Antibody | anti-RSC1A1 antibody

RSC1A1 (Regulatory Solute Carrier Protein Family 1 Member 1, Transporter Regulator RS1, hRS1)

Cat. Num. AAA642484

• Gene Names: RSC1A1; RS1
• Reactivity: Human
• Applications: ELISA, Western Blot, Immunohistochemistry
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: RSC1A1; Monoclonal Antibody; RSC1A1 (Regulatory Solute Carrier Protein Family 1 Member 1; Transporter Regulator RS1; hRS1); Anti -RSC1A1 (Regulatory Solute Carrier Protein Family 1 Member 1; anti-RSC1A1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 6F9
• Specificity: Recognizes human RSC1A1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MSSLPTSDGFNHPARSSGQSPDVGNPMSLARSVSASVCPIKPSDSDRIEPKAVKALKASAEFQLNSEKKEHLSLQDLSDHASSADHAPTDQSPAMPMQNS

• Applicable Applications for anti-RSC1A1 antibody: ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
• Application Notes: Suitable for use in ELISA, Western Blot and Immunohistochemistry.; Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1.2ug/ml
• Immunogen: Partial recombinant corresponding to aa1-101 from human RSC1A1 (NP_006502) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to RSC1A1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1.2ug/ml])

Related Product Information for anti-RSC1A1 antibody

RSC1A1 mediates transcriptional and post-transcriptional regulation of SLC5A1. The protein inhibits a dynamin and PKC-dependent exocytotic pathway of SLC5A1 and is also involved in transcriptional regulation of SLC22A2. It exhibits glucose-dependent, short-term inhibition of SLC5A1 and SLC22A2 by inhibiting the release of vesicles from the trans-Golgi network.

Product Categories/Family for anti-RSC1A1 antibody

Antibodies; Abs to Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 5730021
• NCBI GeneID: 6248
• NCBI Accession #: NP_006502.1
• NCBI GenBank Nucleotide #: NM_006511.1
• UniProt Accession #: Q92681; B2RBP5
• Molecular Weight: 66,790 Da
• NCBI Official Full Name: regulatory solute carrier protein family 1 member 1
• NCBI Official Synonym Full Names: regulatory solute carrier protein, family 1, member 1
• NCBI Official Symbol: RSC1A1
• NCBI Official Synonym Symbols: RS1
• NCBI Protein Information: regulatory solute carrier protein family 1 member 1; transporter regulator RS1
• UniProt Protein Name: Regulatory solute carrier protein family 1 member 1
• Protein Family: Regulatory solute carrier protein family
• UniProt Gene Name: RSC1A1
• UniProt Synonym Gene Names: hRS1
• UniProt Entry Name: RSCA1_HUMAN

Uniprot Description

RSC1A1: Mediates transcriptional and post-transcriptional regulation of SLC5A1. Inhibits a dynamin and PKC-dependent exocytotic pathway of SLC5A1. Also involved in transcriptional regulation of SLC22A2. Exhibits glucose-dependent, short-term inhibition of SLC5A1 and SLC22A2 by inhibiting the release of vesicles from the trans-Golgi network.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 1p36.1

Cellular Component: nucleoplasm; Golgi apparatus; intracellular membrane-bound organelle; plasma membrane; cell junction; nucleus

Molecular Function: ion channel inhibitor activity

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent; transport; negative regulation of transport