Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of RRM1 expression in transfected 293T cell line by RRM1 monoclonal antibody (M09), clone 2F12.Lane 1: RRM1 transfected lysate (Predicted MW: 90.1 KDa).Lane 2: Non-transfected lysate.)

Mouse RRM1 Monoclonal Antibody | anti-RRM1 antibody

RRM1 (Ribonucleotide Reductase M1, R1, RIR1, RR1) (FITC)

Gene Names
RRM1; R1; RR1; RIR1; RRM1
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
RRM1; Monoclonal Antibody; RRM1 (Ribonucleotide Reductase M1; R1; RIR1; RR1) (FITC); Ribonucleotide Reductase M1; RR1; anti-RRM1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F12
Specificity
Recognizes RRM1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-RRM1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
RRM1 (NP_001024.1, 593aa-792aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RRM1 expression in transfected 293T cell line by RRM1 monoclonal antibody (M09), clone 2F12.Lane 1: RRM1 transfected lysate (Predicted MW: 90.1 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RRM1 expression in transfected 293T cell line by RRM1 monoclonal antibody (M09), clone 2F12.Lane 1: RRM1 transfected lysate (Predicted MW: 90.1 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-RRM1 antibody
This gene encodes one of two non-identical subunits that constitute ribonucleoside-diphosphate reductase, an enzyme essential for the production of deoxyribonucleotides prior to DNA synthesis in S phase of dividing cells. It is one of several genes located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocrotical carcinoma, and lung, ovarian, and breast cancer. This gene may play a role in malignancies and disease that involve this region. [provided by RefSeq]
Product Categories/Family for anti-RRM1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
ribonucleoside-diphosphate reductase large subunit [Homo sapiens]
NCBI Official Synonym Full Names
ribonucleotide reductase M1
NCBI Official Symbol
RRM1
NCBI Official Synonym Symbols
R1; RR1; RIR1; RRM1
UniProt Protein Name
Ribonucleoside-diphosphate reductase large subunit
UniProt Gene Name
RRM1
UniProt Synonym Gene Names
RR1
UniProt Entry Name
RIR1_HUMAN

Uniprot Description

RRM1: an enzyme involved in DNA replication that provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides. Belongs to the ribonucleoside diphosphate reductase large chain family. Heterodimer of a large and a small subunit. Heterodimer with small subunit RRM2 or RRM2B. The heterodimer with RRM2 has higher catalytic activity than the heterodimer with RRM2B. Under complex allosteric control mediated by deoxynucleoside triphosphates and ATP binding to separate specificity and activation sites on the M1 subunit. The type of nucleotide bound at the specificity site determines substrate preference. It seems probable that ATP makes the enzyme reduce CDP and UDP, dGTP favors ADP reduction and dTTP favors GDP reduction. Stimulated by ATP and inhibited by dATP binding to the activity site. Two distinct regulatory sites have been defined: the specificity site, which controls substrate specificity, and the activity site which regulates overall catalytic activity. A substrate-binding catalytic site, located on M1, is formed only in the presence of the second subunit M2. The level of the enzyme activity is closely correlated with the growth rate of a cell and appears to vary with the cell cycle. Patients with advanced non-small cell lung cancer responded favorably to gemcitabine.

Protein type: Nucleotide Metabolism - purine; Other Amino Acids Metabolism - glutathione; DNA replication; EC 1.17.4.1; Nucleotide Metabolism - pyrimidine; Oxidoreductase

Chromosomal Location of Human Ortholog: 11p15.5

Cellular Component: nucleoplasm; cell projection; cell soma; cytoplasm; nuclear envelope; cytosol

Molecular Function: protein binding; ATP binding; ribonucleoside-diphosphate reductase activity

Biological Process: pyrimidine base metabolic process; nucleobase, nucleoside and nucleotide metabolic process; nucleobase, nucleoside and nucleotide interconversion; retina development in camera-type eye; cell proliferation in forebrain; male gonad development; deoxyribonucleotide biosynthetic process; protein heterotetramerization; mitotic cell cycle; response to ionizing radiation; DNA replication

Similar Products

Product Notes

The RRM1 rrm1 (Catalog #AAA6178605) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's RRM1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RRM1 rrm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RRM1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.