Mouse RRM1 Monoclonal Antibody | anti-RRM1 antibody

RRM1 (Ribonucleotide Reductase M1, R1, RIR1, RR1) (Biotin)

Cat. Num. AAA6174195

• Gene Names: RRM1; R1; RR1; RIR1; RRM1
• Applications: ELISA, Western Blot
• Purity: Purified
• Synonyms: RRM1; Monoclonal Antibody; RRM1 (Ribonucleotide Reductase M1; R1; RIR1; RR1) (Biotin); Ribonucleotide Reductase M1; RR1; anti-RRM1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2F12
• Specificity: Recognizes RRM1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-RRM1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: RRM1 (NP_001024.1, 593aa-792aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: IRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RRM1 expression in transfected 293T cell line by RRM1 monoclonal antibody (M09), clone 2F12.Lane 1: RRM1 transfected lysate (Predicted MW: 90.1 KDa).Lane 2: Non-transfected lysate.)

Related Product Information for anti-RRM1 antibody

This gene encodes one of two non-identical subunits that constitute ribonucleoside-diphosphate reductase, an enzyme essential for the production of deoxyribonucleotides prior to DNA synthesis in S phase of dividing cells. It is one of several genes located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocrotical carcinoma, and lung, ovarian, and breast cancer. This gene may play a role in malignancies and disease that involve this region. [provided by RefSeq]

Product Categories/Family for anti-RRM1 antibody

Antibodies; Enzymes; Reductase

NCBI and Uniprot Product Information

• NCBI GI #: 4506749
• NCBI GeneID: 6240
• UniProt Accession #: P23921; Q9UNN2
• NCBI Official Full Name: ribonucleoside-diphosphate reductase large subunit [Homo sapiens]
• NCBI Official Synonym Full Names: ribonucleotide reductase M1
• NCBI Official Symbol: RRM1
• NCBI Official Synonym Symbols: R1; RR1; RIR1; RRM1
• UniProt Protein Name: Ribonucleoside-diphosphate reductase large subunit
• UniProt Gene Name: RRM1
• UniProt Synonym Gene Names: RR1
• UniProt Entry Name: RIR1_HUMAN

Uniprot Description

RRM1: an enzyme involved in DNA replication that provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides. Belongs to the ribonucleoside diphosphate reductase large chain family. Heterodimer of a large and a small subunit. Heterodimer with small subunit RRM2 or RRM2B. The heterodimer with RRM2 has higher catalytic activity than the heterodimer with RRM2B. Under complex allosteric control mediated by deoxynucleoside triphosphates and ATP binding to separate specificity and activation sites on the M1 subunit. The type of nucleotide bound at the specificity site determines substrate preference. It seems probable that ATP makes the enzyme reduce CDP and UDP, dGTP favors ADP reduction and dTTP favors GDP reduction. Stimulated by ATP and inhibited by dATP binding to the activity site. Two distinct regulatory sites have been defined: the specificity site, which controls substrate specificity, and the activity site which regulates overall catalytic activity. A substrate-binding catalytic site, located on M1, is formed only in the presence of the second subunit M2. The level of the enzyme activity is closely correlated with the growth rate of a cell and appears to vary with the cell cycle. Patients with advanced non-small cell lung cancer responded favorably to gemcitabine.

Protein type: Nucleotide Metabolism - purine; Other Amino Acids Metabolism - glutathione; DNA replication; EC 1.17.4.1; Nucleotide Metabolism - pyrimidine; Oxidoreductase

Chromosomal Location of Human Ortholog: 11p15.5

Cellular Component: nucleoplasm; cell projection; cell soma; cytoplasm; nuclear envelope; cytosol

Molecular Function: protein binding; ATP binding; ribonucleoside-diphosphate reductase activity

Biological Process: pyrimidine base metabolic process; nucleobase, nucleoside and nucleotide metabolic process; nucleobase, nucleoside and nucleotide interconversion; retina development in camera-type eye; cell proliferation in forebrain; male gonad development; deoxyribonucleotide biosynthetic process; protein heterotetramerization; mitotic cell cycle; response to ionizing radiation; DNA replication