Mouse RRAS2 Monoclonal Antibody | anti-RRAS2 antibody

RRAS2 (Ras-related Protein R-Ras2, Ras-like Protein TC21, Teratocarcinoma Oncogene, TC21) (PE)

Cat. Num. AAA6160067

• Reactivity: Human, Mouse, Rat
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RRAS2; Monoclonal Antibody; RRAS2 (Ras-related Protein R-Ras2; Ras-like Protein TC21; Teratocarcinoma Oncogene; TC21) (PE); anti-RRAS2 antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2D3-4B8
• Specificity: Recognizes human RRAS2. Species Crossreactivity: mouse and rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-RRAS2 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 5ug/ml; IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-205 from RRAS2 (AAH13106) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF*
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (48.55kD).)

Western Blot (WB)

(RRAS2 monoclonal antibody Western Blot analysis of RRAS2 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of RRAS2 expression in transfected 293T cell line by RRAS2 monoclonal antibody Lane 1: RRAS2 transfected lysate (Predicted MW: 23.4kD. Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to RRAS2 on formalin-fixed paraffin-embedded human dysgerminoma tissue. [antibody concentration 5ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RRAS2 on A-431 cell. [antibody concentration 10ug/ml])

Western Blot (WB)

(RRAS2 monoclonal antibody Western Blot analysis of RRAS2 expression in NIH/3T3)

Western Blot (WB)

(RRAS2 monoclonal antibody Western Blot analysis of RRAS2 expression in A-431.)

Product Categories/Family for anti-RRAS2 antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

References

1. In Vivo Regulation of TGF-?] by R-Ras2 Revealed through Loss of the RasGAP Protein NF1. Patmore DM, Welch S, Fulkerson PC, Wu J, Choi K, Eaves D, Kordich JJ, Collins MH, Cripe TP, Ratner N.Cancer Res. 2012 Oct 15;72(20):5317-27. doi: 10.1158/0008- 5472.CAN-12-1972. Epub 2012 Aug 23.

NCBI and Uniprot Product Information

• NCBI GI #: 15341856
• NCBI GeneID: 22800
• Molecular Weight: 24,196 Da
• NCBI Official Full Name: Homo sapiens related RAS viral (r-ras) oncogene homolog 2, mRNA
• Protein Family: Ras-related protein