Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (RPS6KA3 monoclonal antibody Western Blot analysis of RPS6KA3 expression in HepG2.)

Mouse anti-Human RPS6KA3 Monoclonal Antibody | anti-RPS6KA3 antibody

RPS6KA3 (ISPK1, MAPKAPK1B, RSK2, Ribosomal Protein S6 Kinase alpha-3, 90kD Ribosomal Protein S6 Kinase 3, Insulin-stimulated Protein Kinase 1, MAP Kinase-activated Protein Kinase 1b, Ribosomal S6 Kinase 2, pp90RSK2) (PE)

Gene Names
RPS6KA3; CLS; RSK; HU-3; RSK2; MRX19; ISPK-1; p90-RSK2; pp90RSK2; MAPKAPK1B; S6K-alpha3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RPS6KA3; Monoclonal Antibody; RPS6KA3 (ISPK1; MAPKAPK1B; RSK2; Ribosomal Protein S6 Kinase alpha-3; 90kD Ribosomal Protein S6 Kinase 3; Insulin-stimulated Protein Kinase 1; MAP Kinase-activated Protein Kinase 1b; Ribosomal S6 Kinase 2; pp90RSK2) (PE); anti-RPS6KA3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2G10
Specificity
Recognizes human RPS6KA3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-RPS6KA3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa2-96 from human RPS6KA3 (NP_004577) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEIAITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQ
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(RPS6KA3 monoclonal antibody Western Blot analysis of RPS6KA3 expression in HepG2.)

Western Blot (WB) (RPS6KA3 monoclonal antibody Western Blot analysis of RPS6KA3 expression in HepG2.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between MAPK3 and RPS6KA3 HeLa cells were stained with MAPK3 rabbit purified polyclonal 1:1200 and RPS6KA3 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between MAPK3 and RPS6KA3 HeLa cells were stained with MAPK3 rabbit purified polyclonal 1:1200 and RPS6KA3 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-RPS6KA3 antibody
This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Mutations in this gene have been associated with Coffin-Lowry syndrome (CLS).
Product Categories/Family for anti-RPS6KA3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
83,736 Da
NCBI Official Full Name
ribosomal protein S6 kinase alpha-3
NCBI Official Synonym Full Names
ribosomal protein S6 kinase, 90kDa, polypeptide 3
NCBI Official Symbol
RPS6KA3
NCBI Official Synonym Symbols
CLS; RSK; HU-3; RSK2; MRX19; ISPK-1; p90-RSK2; pp90RSK2; MAPKAPK1B; S6K-alpha3
NCBI Protein Information
ribosomal protein S6 kinase alpha-3

NCBI Description

This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Mutations in this gene have been associated with Coffin-Lowry syndrome (CLS). [provided by RefSeq, Jul 2008]

Research Articles on RPS6KA3

Similar Products

Product Notes

The RPS6KA3 (Catalog #AAA6160058) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RPS6KA3 (ISPK1, MAPKAPK1B, RSK2, Ribosomal Protein S6 Kinase alpha-3, 90kD Ribosomal Protein S6 Kinase 3, Insulin-stimulated Protein Kinase 1, MAP Kinase-activated Protein Kinase 1b, Ribosomal S6 Kinase 2, pp90RSK2) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RPS6KA3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RPS6KA3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RPS6KA3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.