Mouse anti-Human RPS27A Monoclonal Antibody | anti-RPS27A antibody

RPS27A (Ubiquitin-40S Ribosomal Protein S27a, Ubiquitin Carboxyl Extension Protein 80, UBA80, UBCEP1) (FITC)

Cat. Num. AAA6149446

• Gene Names: RPS27A; UBC; S27A; CEP80; UBA80; HEL112; UBCEP1; UBCEP80
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RPS27A; Monoclonal Antibody; RPS27A (Ubiquitin-40S Ribosomal Protein S27a; Ubiquitin Carboxyl Extension Protein 80; UBA80; UBCEP1) (FITC); anti-RPS27A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1, lambda
• Clone Number: 3E2-E6
• Specificity: Recognizes human RPS27A.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-RPS27A antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-156 from human RPS27A (AAH01392) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(RPS27A monoclonal antibody, Western Blot analysis of RPS27A expression in HL-60.)

Product Categories/Family for anti-RPS27A antibody

Antibodies; Ribosomal Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 34783094
• NCBI GeneID: 6233
• Molecular Weight: 17,965 Da
• NCBI Official Full Name: Homo sapiens ribosomal protein S27a, mRNA
• NCBI Official Synonym Full Names: ribosomal protein S27a
• NCBI Official Symbol: RPS27A
• NCBI Official Synonym Symbols: UBC; S27A; CEP80; UBA80; HEL112; UBCEP1; UBCEP80
• NCBI Protein Information: ubiquitin-40S ribosomal protein S27a
• Protein Family: 40S ribosomal protein

NCBI Description

Ubiquitin, a highly conserved protein that has a major role in targeting cellular proteins for degradation by the 26S proteosome, is synthesized as a precursor protein consisting of either polyubiquitin chains or a single ubiquitin fused to an unrelated protein. This gene encodes a fusion protein consisting of ubiquitin at the N terminus and ribosomal protein S27a at the C terminus. When expressed in yeast, the protein is post-translationally processed, generating free ubiquitin monomer and ribosomal protein S27a. Ribosomal protein S27a is a component of the 40S subunit of the ribosome and belongs to the S27AE family of ribosomal proteins. It contains C4-type zinc finger domains and is located in the cytoplasm. Pseudogenes derived from this gene are present in the genome. As with ribosomal protein S27a, ribosomal protein L40 is also synthesized as a fusion protein with ubiquitin; similarly, ribosomal protein S30 is synthesized as a fusion protein with the ubiquitin-like protein fubi. Multiple alternatively spliced transcript variants that encode the same proteins have been identified.[provided by RefSeq, Sep 2008]