Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged RPS27A is approximately 3ng/ml as a capture antibody.)

Mouse RPS27A Monoclonal Antibody | anti-RPS27A antibody

RPS27A (Ribosomal Protein S27a, CEP80, HUBCEP80, UBA80, UBCEP1, UBCEP80) (AP)

Gene Names
RPS27A; UBC; S27A; CEP80; UBA80; HEL112; UBCEP1; UBCEP80
Applications
ELISA
Purity
Purified
Synonyms
RPS27A; Monoclonal Antibody; RPS27A (Ribosomal Protein S27a; CEP80; HUBCEP80; UBA80; UBCEP1; UBCEP80) (AP); Ribosomal Protein S27a; UBCEP80; anti-RPS27A antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G10
Specificity
Recognizes RPS27A.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
156
Applicable Applications for anti-RPS27A antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
RPS27A (NP_002945.1, 57aa-156aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged RPS27A is approximately 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RPS27A is approximately 3ng/ml as a capture antibody.)
Related Product Information for anti-RPS27A antibody
Ubiquitin, a highly conserved protein that has a major role in targeting cellular proteins for degradation by the 26S proteosome, is synthesized as a precursor protein consisting of either polyubiquitin chains or a single ubiquitin fused to an unrelated protein. This gene encodes a fusion protein consisting of ubiquitin at the N terminus and ribosomal protein S27a at the C terminus. When expressed in yeast, the protein is post-translationally processed, generating free ubiquitin monomer and ribosomal protein S27a. Ribosomal protein S27a is a component of the 40S subunit of the ribosome and belongs to the S27AE family of ribosomal proteins. It contains C4-type zinc finger domains and is located in the cytoplasm. Pseudogenes derived from this gene are present in the genome. As with ribosomal protein S27a, ribosomal protein L40 is also synthesized as a fusion protein with ubiquitin; similarly, ribosomal protein S30 is synthesized as a fusion protein with the ubiquitin-like protein fubi. Multiple alternatively spliced transcript variants that encode the same proteins have been identified. [provided by RefSeq]
Product Categories/Family for anti-RPS27A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
ubiquitin-40S ribosomal protein S27a
NCBI Official Synonym Full Names
ribosomal protein S27a
NCBI Official Symbol
RPS27A
NCBI Official Synonym Symbols
UBC; S27A; CEP80; UBA80; HEL112; UBCEP1; UBCEP80
NCBI Protein Information
ubiquitin-40S ribosomal protein S27a
UniProt Protein Name
Ubiquitin-40S ribosomal protein S27a
Protein Family
UniProt Gene Name
RPS27A
UniProt Synonym Gene Names
UBA80; UBCEP1
UniProt Entry Name
RS27A_HUMAN

NCBI Description

Ubiquitin, a highly conserved protein that has a major role in targeting cellular proteins for degradation by the 26S proteosome, is synthesized as a precursor protein consisting of either polyubiquitin chains or a single ubiquitin fused to an unrelated protein. This gene encodes a fusion protein consisting of ubiquitin at the N terminus and ribosomal protein S27a at the C terminus. When expressed in yeast, the protein is post-translationally processed, generating free ubiquitin monomer and ribosomal protein S27a. Ribosomal protein S27a is a component of the 40S subunit of the ribosome and belongs to the S27AE family of ribosomal proteins. It contains C4-type zinc finger domains and is located in the cytoplasm. Pseudogenes derived from this gene are present in the genome. As with ribosomal protein S27a, ribosomal protein L40 is also synthesized as a fusion protein with ubiquitin; similarly, ribosomal protein S30 is synthesized as a fusion protein with the ubiquitin-like protein fubi. Multiple alternatively spliced transcript variants that encode the same proteins have been identified.[provided by RefSeq, Sep 2008]

Uniprot Description

RPS27A: the gene (RPS27A) that encodes this protein is one of four that encode for ubiquitin: UBC, UBB, UBA52 and RPS27A. UBB and UBC genes code for a polyubiquitin precursor with exact head to tail repeats, the number of repeats differ between species and strains. UBA52 and RPS27A genes code for a single copy of ubiquitin fused to the ribosomal proteins L40 and S27a, respectively. The RPS27A gene product is cleaved into the following 2 chains: ubiquitin (amino acids 1-76) and the 40S ribosomal protein S27a (amino acids 77-156). Ubiquitin is a peptide 76 amino acids in length that can be covalently attached to target lysines either as a monomer or as a lysine-linked polymer. Hundreds of ubiquitin ligases and hydrolases have been identified, implicating ubiquitin as a major regulatory element in many crucial cellular systems. It can be covalently bound to target proteins via an isopeptide bond either as a monomer (monoubiquitin), a polymer linked via different Lys residues of the ubiquitin (polyubiquitin chains) or a linear polymer linked via the initiator Met of the ubiquitin (linear polyubiquitin chains). Polyubiquitin chains, when attached to a target protein, have different functions depending on the Lys residue of the ubiquitin that is linked: Lys-6-linked may be involved in DNA repair; Lys-11-linked is involved in ERAD (endoplasmic reticulum-associated degradation) and in cell-cycle regulation; Lys-29-linked is involved in lysosomal degradation; Lys-33-linked is involved in kinase modification; Lys-48-linked is involved in protein degradation via the proteasome; Lys-63-linked is involved in endocytosis, DNA-damage responses as well as in signaling processes leading to activation of the transcription factor NF-kappa-B. Linear polymer chains formed via attachment by the initiator Met lead to cell signaling. Ubiquitin is usually conjugated to Lys residues of target proteins, however, in rare cases, conjugation to Cys or Ser residues has been observed. When polyubiquitin is free (unanchored-polyubiquitin), it also has distinct roles, such as in activation of protein kinases, and in signaling. At the protein level, it is not possible to easily determine which of the four genes encoded a given ubiquitin chain.

Protein type: Ribosomal; Ubiquitin-like modifier

Chromosomal Location of Human Ortholog: 2p16

Cellular Component: nucleoplasm; small ribosomal subunit; membrane; cytoplasm; nucleolus; plasma membrane; endosome membrane; cytosol

Molecular Function: structural constituent of ribosome; metal ion binding

Biological Process: circadian rhythm; I-kappaB kinase/NF-kappaB cascade; SRP-dependent cotranslational protein targeting to membrane; negative regulation of ubiquitin-protein ligase activity during mitotic cell cycle; protein polyubiquitination; nerve growth factor receptor signaling pathway; viral reproduction; positive regulation of apoptosis; activation of MAPK activity; stress-activated MAPK cascade; toll-like receptor 3 signaling pathway; endosome transport; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; T cell receptor signaling pathway; activation of NF-kappaB transcription factor; toll-like receptor 5 signaling pathway; regulation of apoptosis; antigen processing and presentation of peptide antigen via MHC class I; transforming growth factor beta receptor signaling pathway; translational initiation; JNK cascade; antigen processing and presentation of exogenous peptide antigen via MHC class I; viral transcription; G2/M transition of mitotic cell cycle; toll-like receptor 4 signaling pathway; regulation of interferon type I production; glycogen biosynthetic process; positive regulation of I-kappaB kinase/NF-kappaB cascade; fibroblast growth factor receptor signaling pathway; transcription, DNA-dependent; Notch receptor processing; glucose metabolic process; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; virus assembly; toll-like receptor 2 signaling pathway; translational elongation; carbohydrate metabolic process; mRNA catabolic process, nonsense-mediated decay; viral protein processing; positive regulation of transcription from RNA polymerase II promoter; toll-like receptor 9 signaling pathway; negative regulation of interferon type I production; negative regulation of apoptosis; G1/S transition of mitotic cell cycle; positive regulation of ubiquitin-protein ligase activity during mitotic cell cycle; negative regulation of epidermal growth factor receptor signaling pathway; translation; apoptosis; pathogenesis; viral infectious cycle; negative regulation of transcription from RNA polymerase II promoter; translational termination; toll-like receptor 10 signaling pathway; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; positive regulation of interferon type I production; transmembrane transport; epidermal growth factor receptor signaling pathway; transcription initiation from RNA polymerase II promoter; Notch signaling pathway; MyD88-independent toll-like receptor signaling pathway; cytokine and chemokine mediated signaling pathway; DNA repair; MyD88-dependent toll-like receptor signaling pathway; cellular protein metabolic process; regulation of ubiquitin-protein ligase activity during mitotic cell cycle; toll-like receptor signaling pathway; innate immune response; gene expression; mitotic cell cycle; negative regulation of transforming growth factor beta receptor signaling pathway

Research Articles on RPS27A

Similar Products

Product Notes

The RPS27A rps27a (Catalog #AAA6164582) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's RPS27A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RPS27A rps27a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RPS27A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.