Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: INASample Tissue: Human 786-0 Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human INA Polyclonal Antibody | anti-INA antibody

INA Antibody - middle region

Gene Names
INA; NEF5; NF-66; TXBP-1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
INA; Polyclonal Antibody; INA Antibody - middle region; anti-INA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DLSQAAARTNEYKIIRTNEKEQLQGLNDRFAVFIEKVHQLETQNRALEAE
Sequence Length
499
Applicable Applications for anti-INA antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human INA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: INASample Tissue: Human 786-0 Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: INASample Tissue: Human 786-0 Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-INA antibody
Neurofilaments are type IV intermediate filament heteropolymers composed of light, medium, and heavy chains. Neurofilaments comprise the axoskeleton and they functionally maintain the neuronal caliber. They may also play a role in intracellular transport to axons and dendrites. This gene is a member of the intermediate filament family and is involved in the morphogenesis of neurons.
Product Categories/Family for anti-INA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55 kDa
NCBI Official Full Name
alpha-internexin
NCBI Official Synonym Full Names
internexin neuronal intermediate filament protein alpha
NCBI Official Symbol
INA
NCBI Official Synonym Symbols
NEF5; NF-66; TXBP-1
NCBI Protein Information
alpha-internexin
UniProt Protein Name
Alpha-internexin
Protein Family
UniProt Gene Name
INA
UniProt Synonym Gene Names
NEF5; Alpha-Inx; NF-66
UniProt Entry Name
AINX_HUMAN

NCBI Description

Neurofilaments are type IV intermediate filament heteropolymers composed of light, medium, and heavy chains. Neurofilaments comprise the axoskeleton and they functionally maintain the neuronal caliber. They may also play a role in intracellular transport to axons and dendrites. This gene is a member of the intermediate filament family and is involved in the morphogenesis of neurons. [provided by RefSeq, Jun 2009]

Uniprot Description

INA: Class-IV neuronal intermediate filament that is able to self-assemble. It is involved in the morphogenesis of neurons. It may form an independent structural network without the involvement of other neurofilaments or it may cooperate with NF-L to form the filamentous backbone to which NF-M and NF-H attach to form the cross-bridges. Belongs to the intermediate filament family.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 10q24.33

Cellular Component: nucleoplasm; extracellular space; intermediate filament cytoskeleton; nuclear membrane; neurofilament

Molecular Function: structural constituent of cytoskeleton

Biological Process: substantia nigra development; neurofilament cytoskeleton organization and biogenesis; cell differentiation

Research Articles on INA

Similar Products

Product Notes

The INA ina (Catalog #AAA3220746) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The INA Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's INA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the INA ina for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DLSQAAARTN EYKIIRTNEK EQLQGLNDRF AVFIEKVHQL ETQNRALEAE. It is sometimes possible for the material contained within the vial of "INA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.