Mouse RPS17 Monoclonal Antibody | anti-rpsQ antibody

RPS17 (40S Ribosomal Protein S17, MGC72007)

Cat. Num. AAA646209

• Reactivity: Human, Mouse, Rat
• Applications: ELISA, Western Blot, Immunohistochemistry
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: RPS17; Monoclonal Antibody; RPS17 (40S Ribosomal Protein S17; MGC72007); Anti -RPS17 (40S Ribosomal Protein S17; anti-rpsQ antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2C7
• Specificity: Recognizes human RPS17. Species Crossreactivity: mouse and rat.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: EEIAIIPSKKLRNKIAGYVTHLMKRIQRGPVRGISIKLQEEERERRDNYVPEVSALDQEIIEVDPDTKEMLKLLDFGSLSNLQVTQPTVGMNFKTPRGPV

• Applicable Applications for anti-rpsQ antibody: ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
• Application Notes: Suitable for use in ELISA, Western Blot and Immunohistochemistry.; Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1.2ug/ml
• Immunogen: Partial recombinant corresponding to aa36-136 from human RPS17 (NP_001012) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(RPS17 monoclonal antibody, Western Blot analysis of RPS17 expression in HeLa.)

Western Blot (WB)

(RPS17 monoclonal antibody. Western Blot analysis of RPS17 expression in PC-12.)

Western Blot (WB)

(RPS17 monoclonal antibody. Western Blot analysis of RPS17 expression in NIH/3T3.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to RPS17 on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 1.2ug/ml])

Testing Data

(Detection limit for recombinant GST tagged RPS17 is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-rpsQ antibody

Defects in RPS17 are the cause of Diamond-Blackfan anemia type 4 (DBA4) [MIM:612527]. DBA4 is a form of Diamond-Blackfan anemia, a congenital non-regenerative hypoplastic anemia that usually presents early in infancy. Diamond-Blackfan anemia is characterized by a moderate to severe macrocytic anemia, erythroblastopenia, and an increased risk of malignancy. 30 to 40% of Diamond-Blackfan anemia patients present with short stature and congenital anomalies, the most frequent being craniofacial (Pierre-Robin syndrome and cleft palate), thumb and urogenital anomalies.

Product Categories/Family for anti-rpsQ antibody

Antibodies; Abs to Ribosomal Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 12721781
• NCBI GeneID: 1244753
• UniProt Accession #: Q9CL40
• Molecular Weight: 9,760 Da
• NCBI Official Full Name: RpS17
• NCBI Official Symbol: rpsQ
• NCBI Protein Information: 30S ribosomal protein S17
• UniProt Protein Name: 30S ribosomal protein S17
• Protein Family: 30S ribosomal protein
• UniProt Gene Name: rpsQ
• UniProt Entry Name: RS17_PASMU

Uniprot Description

Function: One of the primary rRNA binding proteins, it binds specifically to the 5'-end of 16S ribosomal RNA

By similarity. HAMAP-Rule MF_01345

Subunit structure: Part of the 30S ribosomal subunit

By similarity. HAMAP-Rule MF_01345

Sequence similarities: Belongs to the ribosomal protein S17P family.