Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse CDX4 Monoclonal Antibody

CDX4 (Homeobox Protein CDX-4, Caudal-type Homeobox Protein 4)

Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
CDX4; Monoclonal Antibody; CDX4 (Homeobox Protein CDX-4; Caudal-type Homeobox Protein 4); Anti -CDX4 (Homeobox Protein CDX-4; anti-CDX4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3F3
Specificity
Recognizes human CDX4. Species Crossreactivity: mouse and rat.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
VWGSPYSPPREDWSVYPGPSSTMGTVPVNDVTSSPAAFCSTDYSNLGPVGGGTSGSSLPGQAGGSLVPTDAGAAKASSPSRSRHSPYAWMRKTVQVTGKT
Applicable Applications for anti-CDX4 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa71-170 from human CDX4 (NP_005184.1) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(CDX4 monoclonal antibody Western Blot analysis of CDX4 expression in HeLa.)

Western Blot (WB) (CDX4 monoclonal antibody Western Blot analysis of CDX4 expression in HeLa.)

Western Blot (WB)

(CDX4 monoclonal antibody. Western Blot analysis of CDX4 expression in PC-12.)

Western Blot (WB) (CDX4 monoclonal antibody. Western Blot analysis of CDX4 expression in PC-12.)

Western Blot (WB)

(CDX4 monoclonal antibody. Western Blot analysis of CDX4 expression in Raw 264.7.)

Western Blot (WB) (CDX4 monoclonal antibody. Western Blot analysis of CDX4 expression in Raw 264.7.)

Testing Data

(Detection limit for recombinant GST tagged CDX4 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CDX4 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(CDX4 monoclonal antibody. Western Blot analysis of CDX4 expression in NIH/3T3.)

Western Blot (WB) (CDX4 monoclonal antibody. Western Blot analysis of CDX4 expression in NIH/3T3.)
Related Product Information for anti-CDX4 antibody
Caudal type homeo box transcription factor 4 (CDX4) is a member of the caudal-type homeobox genes which are candidates for directing tissue and organ development and differentiation. CDX1 and CDX2 expression is widely present in the human intestinal and colonic mucosae, but not in the gastric mucosa, suggesting a possible role in the terminal differentiation of the intestine. CDX4 is located within the minimal region assigned to XIC in humans and furthermore, CDX4 is the closest known gene to XIST in both mouse and human. Unlike Xist, CDX4 appears to be normally X-inactivated in mice and it is not clear yet whether the location of this gene within the XIC region is of any significance in X-inactivation.
Product Categories/Family for anti-CDX4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Official Full Name
caudal-4
Protein Family

Uniprot Description

CDX4: a member of a small subfamily of homeobox containing transcription factors. The encoded protein may regulate homeobox gene expression during anteroposterior patterning and hematopoiesis. [provided by RefSeq, Aug 2012]

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: Xq13.2

Cellular Component: nucleus

Biological Process: anterior/posterior pattern formation; blood vessel development; transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter

Similar Products

Product Notes

The CDX4 (Catalog #AAA6012928) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CDX4 (Homeobox Protein CDX-4, Caudal-type Homeobox Protein 4) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CDX4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the CDX4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VWGSPYSPPR EDWSVYPGPS STMGTVPVND VTSSPAAFCS TDYSNLGPVG GGTSGSSLPG QAGGSLVPTD AGAAKASSPS RSRHSPYAWM RKTVQVTGKT. It is sometimes possible for the material contained within the vial of "CDX4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.