Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.65kD).)

Mouse anti-Human, Rat HSPA1L Monoclonal Antibody | anti-HSPA1L antibody

HSPA1L (Heat Shock 70kD Protein 1-like, HSP70-Hom, Heat shock 70kD protein 1L, Heat Shock 70kD Protein 1-Hom)

Gene Names
HSPA1L; HSP70T; hum70t; HSP70-1L; HSP70-HOM
Reactivity
Human, Rat
Applications
ELISA, Western Blot, Immunohistochemistry
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
HSPA1L; Monoclonal Antibody; HSPA1L (Heat Shock 70kD Protein 1-like; HSP70-Hom; Heat shock 70kD protein 1L; Heat Shock 70kD Protein 1-Hom); Anti -HSPA1L (Heat Shock 70kD Protein 1-like; anti-HSPA1L antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
7H6
Specificity
Recognizes human HSPA1L. Species Crossreactivity: rat.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
KGKISESDKNKILDKCNELLSWLEVNQLAEKDEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD
Applicable Applications for anti-HSPA1L antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Partial recombinant corresponding to aa561-641 from human HSPA1L (NP_005518) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.65kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.65kD).)

Western Blot (WB)

(HSPA1L monoclonal antibody Western Blot analysis of HSPA1L expression in HeLa.)

Western Blot (WB) (HSPA1L monoclonal antibody Western Blot analysis of HSPA1L expression in HeLa.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to HSPA1L on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to HSPA1L on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged HSPA1L is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HSPA1L is ~0.1ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between MAP3K7 and HSPA1L HeLa cells were stained with MAP3K7 rabbit purified polyclonal 1:1200 and HSPA1L mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between MAP3K7 and HSPA1L HeLa cells were stained with MAP3K7 rabbit purified polyclonal 1:1200 and HSPA1L mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Western Blot (WB)

(HSPA1L monoclonal antibody Western Blot analysis of HSPA1L expression in PC-12.)

Western Blot (WB) (HSPA1L monoclonal antibody Western Blot analysis of HSPA1L expression in PC-12.)
Related Product Information for anti-HSPA1L antibody
HSPA1L is a 70kD heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles.
Product Categories/Family for anti-HSPA1L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70,375 Da
NCBI Official Full Name
heat shock 70 kDa protein 1-like
NCBI Official Synonym Full Names
heat shock 70kDa protein 1-like
NCBI Official Symbol
HSPA1L
NCBI Official Synonym Symbols
HSP70T; hum70t; HSP70-1L; HSP70-HOM
NCBI Protein Information
heat shock 70 kDa protein 1-like; heat shock 70 kDa protein 1L; heat shock 70kD protein-like 1; heat shock 10kDa protein 1-like; heat shock 70 kDa protein 1-Hom
UniProt Protein Name
Heat shock 70 kDa protein 1-like
Protein Family
UniProt Gene Name
HSPA1L
UniProt Synonym Gene Names
Heat shock 70 kDa protein 1L; HSP70-Hom
UniProt Entry Name
HS71L_HUMAN

NCBI Description

This gene encodes a 70kDa heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. The gene is located in the major histocompatibility complex class III region, in a cluster with two closely related genes which also encode isoforms of the 70kDa heat shock protein. [provided by RefSeq, Jul 2008]

Uniprot Description

HSPA1L: In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage. Not induced by heat shock. Expressed in spermatids. Belongs to the heat shock protein 70 family.

Protein type: Chaperone; Heat shock protein; Mitochondrial

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: signalosome; nucleoplasm; mitochondrial matrix; cytosol

Molecular Function: protein binding; unfolded protein binding; ATP binding

Biological Process: binding of sperm to zona pellucida; protein refolding; response to unfolded protein

Research Articles on HSPA1L

Similar Products

Product Notes

The HSPA1L hspa1l (Catalog #AAA6010684) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HSPA1L (Heat Shock 70kD Protein 1-like, HSP70-Hom, Heat shock 70kD protein 1L, Heat Shock 70kD Protein 1-Hom) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HSPA1L can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in ELISA, Western Blot and Immunohistochemistry. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the HSPA1L hspa1l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KGKISESDKN KILDKCNELL SWLEVNQLAE KDEFDHKRKE LEQMCNPIIT KLYQGGCTGP ACGTGYVPGR PATGPTIEEV D. It is sometimes possible for the material contained within the vial of "HSPA1L, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.