Mouse anti-Human RPP40 Monoclonal Antibody | anti-RPP40 antibody

RPP40 (Ribonuclease P Protein Subunit p40, RNaseP Protein p40, RNase P Subunit 1, RNASEP1) (MaxLight 550)

Cat. Num. AAA6213742

• Gene Names: RPP40; RNASEP1; bA428J1.3
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RPP40; Monoclonal Antibody; RPP40 (Ribonuclease P Protein Subunit p40; RNaseP Protein p40; RNase P Subunit 1; RNASEP1) (MaxLight 550); anti-RPP40 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1G8
• Specificity: Recognizes human RPP40.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.

• Applicable Applications for anti-RPP40 antibody: FLISA, Western Blot (WB)
• Application Notes: Sandwich FLISA: The detection limit for recombinant GST tagged RPP40 is 0.1ng/ml as a capture antibody; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa295-363 from human RPP40 (NP_006629) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EHLCHYFDEPKLAPWVTLSVQGFADSPVSWEKNEHGFRKGGEHLYNFVIFNNQDYWLQMAVGANDHCPP
• Conjugate: MaxLight550
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Product Categories/Family for anti-RPP40 antibody

Antibodies; Enzymes; Ribonuclease

NCBI and Uniprot Product Information

• NCBI GI #: 55743132
• NCBI GeneID: 10799
• NCBI Accession #: NP_006629
• NCBI GenBank Nucleotide #: NM_006638
• UniProt Accession #: O75818
• Molecular Weight: 18kDa
• NCBI Official Full Name: ribonuclease P protein subunit p40 isoform a
• NCBI Official Synonym Full Names: ribonuclease P/MRP subunit p40
• NCBI Official Symbol: RPP40
• NCBI Official Synonym Symbols: RNASEP1; bA428J1.3
• NCBI Protein Information: ribonuclease P protein subunit p40
• UniProt Protein Name: Ribonuclease P protein subunit p40
• Protein Family: Ribonuclease P protein
• UniProt Gene Name: RPP40
• UniProt Synonym Gene Names: RNASEP1; RNaseP protein p40
• UniProt Entry Name: RPP40_HUMAN

Uniprot Description

Function: Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends.

Catalytic activity: Endonucleolytic cleavage of RNA, removing 5'-extranucleotides from tRNA precursor.

Subunit structure: RNase P consists of a RNA moiety and at least 8 protein subunits; POP1, RPP14, RPP20/POP7, RPP25, RPP29/POP4, RPP30, RPP38 and RPP40.

Subcellular location: Nucleus › nucleolus

Potential.

Sequence caution: The sequence AAC24114.1 differs from that shown. Reason: Erroneous initiation. The sequence AAH17871.1 differs from that shown. Reason: Frameshift at position 327. The sequence CAH73740.1 differs from that shown. Reason: Erroneous initiation.