Mouse anti-Human RPP40 Monoclonal Antibody | anti-RPP40 antibody

RPP40 (Ribonuclease P Protein Subunit p40, RNaseP Protein p40, RNase P Subunit 1, RNASEP1)

Cat. Num. AAA6002231

• Gene Names: RPP40; RNASEP1; bA428J1.3
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: RPP40; Monoclonal Antibody; RPP40 (Ribonuclease P Protein Subunit p40; RNaseP Protein p40; RNase P Subunit 1; RNASEP1); Anti -RPP40 (Ribonuclease P Protein Subunit p40; anti-RPP40 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1G8
• Specificity: Recognizes human RPP40.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: EHLCHYFDEPKLAPWVTLSVQGFADSPVSWEKNEHGFRKGGEHLYNFVIFNNQDYWLQMAVGANDHCPP

• Applicable Applications for anti-RPP40 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.; Dilution: Sandwich ELISA: The detection limit for recombinant GST tagged RPP40 is 0.1ng/ml as a capture antibody
• Immunogen: Partial recombinant corresponding to aa295-363 from human RPP40 (NP_006629) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RPP40 expression in transfected 293T cell line by RPP40 monoclonal antibody.|Lane 1: RPP40 transfected lysate (Predicted MW: 28kD).|Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged RPP40 is 0.1ng/ml as a capture antibody.)

Related Product Information for anti-RPP40 antibody

Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends.

Product Categories/Family for anti-RPP40 antibody

Antibodies; Abs to Enzymes; Ribonuclease

NCBI and Uniprot Product Information

• NCBI GI #: 17389705
• NCBI GeneID: 10799
• UniProt Accession #: O75818; Q5VX97; Q8WVK8
• Molecular Weight: 41,834 Da
• NCBI Official Full Name: RPP40 protein
• NCBI Official Synonym Full Names: ribonuclease P/MRP 40kDa subunit
• NCBI Official Symbol: RPP40
• NCBI Official Synonym Symbols: RNASEP1; bA428J1.3
• NCBI Protein Information: ribonuclease P protein subunit p40; ribonuclease P1; RNase P subunit 1; RNaseP protein p40; ribonuclease P (40 kD); ribonuclease P 40kDa subunit; ribonuclease P, 40kD subunit
• UniProt Protein Name: Ribonuclease P protein subunit p40
• Protein Family: Ribonuclease P protein
• UniProt Gene Name: RPP40
• UniProt Synonym Gene Names: RNASEP1; RNaseP protein p40
• UniProt Entry Name: RPP40_HUMAN

Uniprot Description

RPP40: Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleolus; EC 3.1.26.5; Ribonuclease

Chromosomal Location of Human Ortholog: 6p25.1

Cellular Component: nucleolar ribonuclease P complex; nucleus

Molecular Function: ribonuclease P activity

Biological Process: tRNA processing