Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse ROD1 Monoclonal Antibody | anti-ROD1 antibody

ROD1 (PTBP3, Polypyrimidine Tract-binding Protein 3, Regulator of Differentiation 1) APC

Gene Names
PTBP3; ROD1
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ROD1; Monoclonal Antibody; ROD1 (PTBP3; Polypyrimidine Tract-binding Protein 3; Regulator of Differentiation 1) APC; anti-ROD1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4C9
Specificity
Recognizes human ROD1. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
7937
Applicable Applications for anti-ROD1 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 20ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa16-114 from ROD1 (NP_005147) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GSDELLSSGIINGPFTMNSSTPSTANGNDSKKFKRDRPPCSPSRVLHLRKIPCDVTEAEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMVNYY
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(ROD1 monoclonal antibody Western Blot analysis of ROD1 expression in PC-12)

Western Blot (WB) (ROD1 monoclonal antibody Western Blot analysis of ROD1 expression in PC-12)

Western Blot (WB)

(ROD1 monoclonal antibody Western Blot analysis of ROD1 expression in Hela NE.)

Western Blot (WB) (ROD1 monoclonal antibody Western Blot analysis of ROD1 expression in Hela NE.)

Western Blot (WB)

(ROD1 monoclonal antibody. Western Blot analysis of ROD1 expression in NIH/3T3)

Western Blot (WB) (ROD1 monoclonal antibody. Western Blot analysis of ROD1 expression in NIH/3T3)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ROD1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to ROD1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ROD1 on HeLa cell. [antibody concentration 20ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ROD1 on HeLa cell. [antibody concentration 20ug/ml])
Product Categories/Family for anti-ROD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens polypyrimidine tract binding protein 3 (PTBP3), transcript variant 1, mRNA
NCBI Official Synonym Full Names
polypyrimidine tract binding protein 3
NCBI Official Symbol
PTBP3
NCBI Official Synonym Symbols
ROD1
NCBI Protein Information
polypyrimidine tract-binding protein 3
UniProt Protein Name
Polypyrimidine tract-binding protein 3
Protein Family
UniProt Gene Name
PTBP3
UniProt Synonym Gene Names
ROD1; Rod1
UniProt Entry Name
PTBP3_HUMAN

NCBI Description

The protein encoded by this gene binds RNA and is a regulator of cell differentiation. The encoded protein preferentially binds to poly(G) and poly(U) sequences in vitro. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Research Articles on ROD1

Similar Products

Product Notes

The ROD1 ptbp3 (Catalog #AAA6138796) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ROD1 (PTBP3, Polypyrimidine Tract-binding Protein 3, Regulator of Differentiation 1) APC reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ROD1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 20ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ROD1 ptbp3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ROD1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.