Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to RNF220 on HeLa cell. [antibody concentration 10ug/ml].)

Mouse anti-Human RNF220 Monoclonal Antibody | anti-RNF220 antibody

RNF220 (E3 Ubiquitin-protein Ligase RNF220, RING Finger Protein 220, C1orf164, FLJ10597) (HRP)

Gene Names
RNF220; C1orf164
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RNF220; Monoclonal Antibody; RNF220 (E3 Ubiquitin-protein Ligase RNF220; RING Finger Protein 220; C1orf164; FLJ10597) (HRP); anti-RNF220 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5E5
Specificity
Recognizes human FLJ10597.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
566
Applicable Applications for anti-RNF220 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa468-567 from human FLJ10597 (NP_060620) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QEAMQKTCKNSDIEKITEDSAVTTFEALKARVRELERQLSRGDRYKCLICMDSYSMPLTSIQCWHVHCEECWLRTLGAKKLCPQCNTITAPGDLRRIYL
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RNF220 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to RNF220 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged C1orf164 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged C1orf164 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-RNF220 antibody
E3 ubiquitin-protein ligase that promotes the ubiquitination and proteasomal degradation of SIN3B.
Product Categories/Family for anti-RNF220 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
E3 ubiquitin-protein ligase RNF220 isoform 1
NCBI Official Synonym Full Names
ring finger protein 220
NCBI Official Symbol
RNF220
NCBI Official Synonym Symbols
C1orf164
NCBI Protein Information
E3 ubiquitin-protein ligase RNF220
UniProt Protein Name
E3 ubiquitin-protein ligase RNF220
UniProt Gene Name
RNF220
UniProt Synonym Gene Names
C1orf164
UniProt Entry Name
RN220_HUMAN

Research Articles on RNF220

Similar Products

Product Notes

The RNF220 rnf220 (Catalog #AAA6152526) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RNF220 (E3 Ubiquitin-protein Ligase RNF220, RING Finger Protein 220, C1orf164, FLJ10597) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RNF220 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RNF220 rnf220 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RNF220, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.