Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human, Mouse RFWD2 Monoclonal Antibody

RFWD2 (E3 Ubiquitin-protein Ligase RFWD2, RING Finger and WD Repeat Domain Protein 2, Constitutive Photomorphogenesis Protein 1 Homolog, hCOP1, RING Finger Protein 200, COP1, RNF200, FLJ10416)

Reactivity
Human, Mouse
Applications
ELISA, Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
RFWD2; Monoclonal Antibody; RFWD2 (E3 Ubiquitin-protein Ligase RFWD2; RING Finger and WD Repeat Domain Protein 2; Constitutive Photomorphogenesis Protein 1 Homolog; hCOP1; RING Finger Protein 200; COP1; RNF200; FLJ10416); Anti -RFWD2 (E3 Ubiquitin-protein Ligase RFWD2; anti-RFWD2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1E4
Specificity
Recognizes human RFWD2. Species Crossreactivity: mouse.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
CLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV
Applicable Applications for anti-RFWD2 antibody
ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence, ELISA and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Partial recombinant corresponding to aa632-732 from human RFWD2 (NP_071902) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(Western Blot analysis of RFWD2 expression in NIH/3T3.)

Western Blot (WB) (Western Blot analysis of RFWD2 expression in NIH/3T3.)

Immunofluorescence (IF)

(Immunofluorescence analysis of RFWD2 in NIH/3T3 cells.)

Immunofluorescence (IF) (Immunofluorescence analysis of RFWD2 in NIH/3T3 cells.)

Testing Data

(Detection limit for recombinant GST tagged RFWD2 is ~0.1ng/ml using antibody MBS649164 as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RFWD2 is ~0.1ng/ml using antibody MBS649164 as a capture antibody.)
Related Product Information for anti-RFWD2 antibody
E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Involved in JUN ubiquitination and degradation. Directly involved in p53 (TP53) ubiquitination and degradation, thereby abolishing p53-dependent transcription and apoptosis. Ubiquitinates p53 independently of MDM2 or RCHY1. Probably mediates E3 ubiquitin ligase activity by functioning as the essential RING domain subunit of larger E3 complexes. In contrast, it does not constitute the catalytic RING subunit in the DCX DET1-COP1 complex that negatively regulates JUN, the ubiquitin ligase activity being mediated by RBX1. Involved in 14-3-3 protein sigma/SFN ubiquitination and proteasomal degradation, leading to AKT activation and promotion of cell survival.
Product Categories/Family for anti-RFWD2 antibody

Similar Products

Product Notes

The RFWD2 (Catalog #AAA649164) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RFWD2 (E3 Ubiquitin-protein Ligase RFWD2, RING Finger and WD Repeat Domain Protein 2, Constitutive Photomorphogenesis Protein 1 Homolog, hCOP1, RING Finger Protein 200, COP1, RNF200, FLJ10416) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's RFWD2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence, ELISA and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the RFWD2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: CLRSFKGHIN EKNFVGLASN GDYIACGSEN NSLYLYYKGL SKTLLTFKFD TVKSVLDKDR KEDDTNEFVS AVCWRALPDG ESNVLIAANS QGTIKVLELV. It is sometimes possible for the material contained within the vial of "RFWD2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.