Testing Data
(Detection limit for recombinant GST tagged RND2 is ~0.1ng/ml as a capture antibody.)
Mouse anti-Human RND2 Monoclonal Antibody | anti-RND2 antibody
RND2 (Rho-related GTP-binding Protein RhoN, RhoN, ARHN, Rho Family GTPase 2, Rho-related GTP-binding Protein Rho7, RHO7) (FITC)
Gene Names
RND2; ARHN; RHO7; RhoN
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RND2; Monoclonal Antibody; RND2 (Rho-related GTP-binding Protein RhoN; RhoN; ARHN; Rho Family GTPase 2; Rho-related GTP-binding Protein Rho7; RHO7) (FITC); anti-RND2 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2D12
Specificity
Recognizes human RND2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-RND2 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-170 from RND2 (AAH18096) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MWDTSGSSYYDNVRPLAYPDSDAVLICFDISRPETLDSVLKKWQGETQEFCPNAKVVLVGCKLDMRTDLATLRELSKQRLIPVTHEQGTVLAKQVGAVSYVECSSRSSERSVRDVFHVATVASLGRGHRQLRRTDSRRGMQRSAQLSGRPDRGNEGEIHKDRAKSCNLM*
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged RND2 is ~0.1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged RND2 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-RND2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
25,369 Da
NCBI Official Full Name
Homo sapiens Rho family GTPase 2, mRNA
NCBI Official Synonym Full Names
Rho family GTPase 2
NCBI Official Symbol
RND2
NCBI Official Synonym Symbols
ARHN; RHO7; RhoN
NCBI Protein Information
rho-related GTP-binding protein RhoN
Protein Family
NCBI Description
This gene encodes a member of the Rho GTPase family, whose members play a key role in the regulation of actin cytoskeleton organization in response to extracellular growth factors. This particular family member has been implicated in the regulation of neuronal morphology and endosomal trafficking. The gene localizes to chromosome 17 and is the centromeric neighbor of the breast-ovarian cancer susceptibility gene BRCA1. [provided by RefSeq, Jul 2008]
Research Articles on RND2
Similar Products
Product Notes
The RND2 (Catalog #AAA6149356) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RND2 (Rho-related GTP-binding Protein RhoN, RhoN, ARHN, Rho Family GTPase 2, Rho-related GTP-binding Protein Rho7, RHO7) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RND2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RND2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RND2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
