Mouse anti-Human RND2 Monoclonal Antibody | anti-RND2 antibody

RND2 (Rho-related GTP-binding Protein RhoN, RhoN, ARHN, Rho Family GTPase 2, Rho-related GTP-binding Protein Rho7, RHO7)

Cat. Num. AAA6003441

• Gene Names: RND2; ARHN; RHO7; RhoN
• Reactivity: Human
• Applications: ELISA
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: RND2; Monoclonal Antibody; RND2 (Rho-related GTP-binding Protein RhoN; RhoN; ARHN; Rho Family GTPase 2; Rho-related GTP-binding Protein Rho7; RHO7); Anti -RND2 (Rho-related GTP-binding Protein RhoN; anti-RND2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2D12
• Specificity: Recognizes human RND2.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MWDTSGSSYYDNVRPLAYPDSDAVLICFDISRPETLDSVLKKWQGETQEFCPNAKVVLVGCKLDMRTDLATLRELSKQRLIPVTHEQGTVLAKQVGAVSYVECSSRSSERSVRDVFHVATVASLGRGHRQLRRTDSRRGMQRSAQLSGRPDRGNEGEIHKDRAKSCNLM*

• Applicable Applications for anti-RND2 antibody: ELISA (EL/EIA)
• Application Notes: Suitable for use in ELISA.
• Immunogen: Full length recombinant corresponding to aa1-170 from RND2 (AAH18096) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged RND2 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-RND2 antibody

Antibodies; Abs to GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 4885581
• NCBI GeneID: 8153
• NCBI Accession #: NP_005431.1
• NCBI GenBank Nucleotide #: NM_005440.4
• UniProt Accession #: P52198; O00690; O00734; Q5U0P6; Q99535; A8K2D4
• Molecular Weight: 25,369 Da
• NCBI Official Full Name: rho-related GTP-binding protein RhoN
• NCBI Official Synonym Full Names: Rho family GTPase 2
• NCBI Official Symbol: RND2
• NCBI Official Synonym Symbols: ARHN; RHO7; RhoN
• NCBI Protein Information: rho-related GTP-binding protein RhoN; GTP-binding protein Rho7; ras homolog gene family, member N; rho-related GTP-binding protein Rho7
• UniProt Protein Name: Rho-related GTP-binding protein RhoN
• Protein Family: Rho-related GTP-binding protein
• UniProt Gene Name: RND2
• UniProt Synonym Gene Names: ARHN; RHO7
• UniProt Entry Name: RND2_HUMAN

NCBI Description

This gene encodes a member of the Rho GTPase family, whose members play a key role in the regulation of actin cytoskeleton organization in response to extracellular growth factors. This particular family member has been implicated in the regulation of neuronal morphology and endosomal trafficking. The gene localizes to chromosome 17 and is the centromeric neighbor of the breast-ovarian cancer susceptibility gene BRCA1. [provided by RefSeq, Jul 2008]

Uniprot Description

RND2: May be specifically involved in neuronal and hepatic functions. Is a C3 toxin-insensitive member of the Rho subfamily. Belongs to the small GTPase superfamily. Rho family.

Protein type: G protein; G protein, monomeric, Rho; G protein, monomeric

Chromosomal Location of Human Ortholog: 17q21

Cellular Component: early endosome; acrosomal membrane

Molecular Function: GTPase activity; protein binding; GTP binding; protein N-terminus binding

Biological Process: metabolic process; small GTPase mediated signal transduction; signal transduction; positive regulation of collateral sprouting