Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse RIPK2 Monoclonal Antibody | anti-RIPK2 antibody

RIPK2 (Receptor-interacting Serine/Threonine Protein Kinase 2, RIP-like Interacting CLARP Kinase, Receptor-interacting Protein 2, RIP-2, CARD-containing Interleukin-1 beta Converting Enzyme Associated Kinase, CARD-containing IL-1 beta ICE-kinase, RIPK2, C

Gene Names
RIPK2; CCK; RICK; RIP2; CARD3; GIG30; CARDIAK
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RIPK2; Monoclonal Antibody; RIPK2 (Receptor-interacting Serine/Threonine Protein Kinase 2; RIP-like Interacting CLARP Kinase; Receptor-interacting Protein 2; RIP-2; CARD-containing Interleukin-1 beta Converting Enzyme Associated Kinase; CARD-containing IL-1 beta ICE-kinase; C; anti-RIPK2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2C7
Specificity
Recognizes human RIPK2. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-RIPK2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa431-541 from RIPK2 (AAH04553) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(IPK2 monoclonal antibody Western Blot analysis of RIPK2 expression in HeLa.)

Western Blot (WB) (IPK2 monoclonal antibody Western Blot analysis of RIPK2 expression in HeLa.)

Western Blot (WB)

(RIPK2 monoclonal antibody Western Blot analysis of RIPK2 expression in PC-12.)

Western Blot (WB) (RIPK2 monoclonal antibody Western Blot analysis of RIPK2 expression in PC-12.)

Western Blot (WB)

(Western Blot analysis of RIPK2 expression in transfected 293T cell line by RIPK2 monoclonal antibody Lane 1: RIPK2 transfected lysate (61.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RIPK2 expression in transfected 293T cell line by RIPK2 monoclonal antibody Lane 1: RIPK2 transfected lysate (61.2kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged RIPK2 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RIPK2 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-RIPK2 antibody
RIPK2 is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein contains a C-terminal recruitment domain (CARD), and is a component of signaling complexes in both the innate and adaptive immune pathways. It is a potent activator of NF-kappaB and inducer of apoptosis in response to various stimuli.
Product Categories/Family for anti-RIPK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
45,582 Da
NCBI Official Full Name
Homo sapiens receptor-interacting serine-threonine kinase 2, mRNA
NCBI Official Synonym Full Names
receptor interacting serine/threonine kinase 2
NCBI Official Symbol
RIPK2
NCBI Official Synonym Symbols
CCK; RICK; RIP2; CARD3; GIG30; CARDIAK
NCBI Protein Information
receptor-interacting serine/threonine-protein kinase 2

NCBI Description

This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein contains a C-terminal caspase activation and recruitment domain (CARD), and is a component of signaling complexes in both the innate and adaptive immune pathways. It is a potent activator of NF-kappaB and inducer of apoptosis in response to various stimuli. [provided by RefSeq, Jul 2008]

Research Articles on RIPK2

Similar Products

Product Notes

The RIPK2 (Catalog #AAA6133436) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RIPK2 (Receptor-interacting Serine/Threonine Protein Kinase 2, RIP-like Interacting CLARP Kinase, Receptor-interacting Protein 2, RIP-2, CARD-containing Interleukin-1 beta Converting Enzyme Associated Kinase, CARD-containing IL-1 beta ICE-kinase, RIPK2, C reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RIPK2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RIPK2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RIPK2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.