Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ACTN4 monoclonal antibody Western Blot analysis of ACTN4 expression in PC-12.)

Mouse ACTN4 Monoclonal Antibody | anti-ACTN4 antibody

ACTN4 (Alpha-actinin-4, Non-muscle alpha-actinin 4, F-actin Cross-linking Protein) (FITC)

Gene Names
ACTN4; FSGS; FSGS1; ACTININ-4
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ACTN4; Monoclonal Antibody; ACTN4 (Alpha-actinin-4; Non-muscle alpha-actinin 4; F-actin Cross-linking Protein) (FITC); anti-ACTN4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4D10
Specificity
Recognizes human ACTN4. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-ACTN4 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 20ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa592-701 from human ACTN4 (NP_004915) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYK
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(ACTN4 monoclonal antibody Western Blot analysis of ACTN4 expression in PC-12.)

Western Blot (WB) (ACTN4 monoclonal antibody Western Blot analysis of ACTN4 expression in PC-12.)

Western Blot (WB)

(Western Blot analysis of ACTN4 expression in transfected 293T cell line by ACTN4 monoclonal antibody. Lane 1: ACTN4 transfected lysate (104.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ACTN4 expression in transfected 293T cell line by ACTN4 monoclonal antibody. Lane 1: ACTN4 transfected lysate (104.9kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ACTN4 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to ACTN4 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ACTN4 on HeLa cell. [antibody concentration 20ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ACTN4 on HeLa cell. [antibody concentration 20ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged ACTN4 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ACTN4 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(ACTN4 monoclonal antibody Western Blot analysis of ACTN4 expression in NIH/3T3.)

Western Blot (WB) (ACTN4 monoclonal antibody Western Blot analysis of ACTN4 expression in NIH/3T3.)

Western Blot (WB)

(ACTN4 monoclonal antibody Western Blot analysis of ACTN4 expression in HeLa NE.)

Western Blot (WB) (ACTN4 monoclonal antibody Western Blot analysis of ACTN4 expression in HeLa NE.)
Product Categories/Family for anti-ACTN4 antibody
References
1. RNAi-mediated down-regulation of alpha-actinin-4 decreases invasion potential in oral squamous cell carcinoma. Yamada S, Yanamoto S, Yoshida H, Yoshitomi I, Kawasaki G, Mizuno A, Nemoto TK.Int J Oral Maxillofac Surg. 2009 Nov 11.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
81
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59,579 Da
NCBI Official Full Name
alpha-actinin-4 isoform 1
NCBI Official Synonym Full Names
actinin alpha 4
NCBI Official Symbol
ACTN4
NCBI Official Synonym Symbols
FSGS; FSGS1; ACTININ-4
NCBI Protein Information
alpha-actinin-4
UniProt Protein Name
Alpha-actinin-4
Protein Family
UniProt Gene Name
ACTN4
UniProt Entry Name
ACTN4_HUMAN

NCBI Description

Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a nonmuscle, alpha actinin isoform which is concentrated in the cytoplasm, and thought to be involved in metastatic processes. Mutations in this gene have been associated with focal and segmental glomerulosclerosis. [provided by RefSeq, Jul 2008]

Uniprot Description

ACTN4: F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein. Probably involved in vesicular trafficking via its association with the CART complex. The CART complex is necessary for efficient transferrin receptor recycling but not for EGFR degradation. Defects in ACTN4 are the cause of focal segmental glomerulosclerosis type 1 (FSGS1). A renal pathology defined by the presence of segmental sclerosis in glomeruli and resulting in proteinuria, reduced glomerular filtration rate and edema. Renal insufficiency often progresses to end-stage renal disease, a highly morbid state requiring either dialysis therapy or kidney transplantation. Belongs to the alpha-actinin family.

Protein type: Motility/polarity/chemotaxis; Cytoskeletal

Chromosomal Location of Human Ortholog: 19q13

Cellular Component: cortical cytoskeleton; extracellular space; neuron projection; focal adhesion; protein complex; perinuclear region of cytoplasm; cytoplasm; stress fiber; extracellular region; intercellular junction; pseudopodium; Z disc; ribonucleoprotein complex; nucleus

Molecular Function: actin filament binding; integrin binding; protein binding; protein homodimerization activity; ligand-dependent nuclear receptor transcription coactivator activity; retinoic acid receptor binding; nucleoside binding; protein N-terminus binding; calcium ion binding; actin binding; nuclear hormone receptor binding

Biological Process: regulation of apoptosis; retinoic acid receptor signaling pathway; platelet activation; actin filament bundle formation; protein transport; platelet degranulation; response to hypoxia; negative regulation of cell motility; positive regulation of cell motility; positive regulation of sodium:hydrogen antiporter activity; positive regulation of pinocytosis; blood coagulation

Disease: Focal Segmental Glomerulosclerosis 1

Research Articles on ACTN4

Similar Products

Product Notes

The ACTN4 actn4 (Catalog #AAA6145767) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ACTN4 (Alpha-actinin-4, Non-muscle alpha-actinin 4, F-actin Cross-linking Protein) (FITC) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ACTN4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 20ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ACTN4 actn4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ACTN4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.