Mouse anti-Human RING1 Monoclonal Antibody | anti-RING1 antibody

RING1 (E3 Ubiquitin-protein Ligase RING1, RING Finger Protein 1, Polycomb Complex Protein RING1, Really Interesting New Gene 1 Protein, RNF1) APC

Cat. Num. AAA6138736

• Gene Names: RING1; RNF1; RING1A
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RING1; Monoclonal Antibody; RING1 (E3 Ubiquitin-protein Ligase RING1; RING Finger Protein 1; Polycomb Complex Protein RING1; Really Interesting New Gene 1 Protein; RNF1) APC; anti-RING1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3G6
• Specificity: Recognizes human RING1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-RING1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa81-171, from human RING1 (NP_002922) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPIPGSDQTTTMS
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RING1 expression in transfected 293T cell line by RING1 monoclonal antibody Lane 1: RING1 transfected lysate (42.4kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-RING1 antibody

RING1 belongs to the RING finger family, members of which encode proteins characterized by a RING domain, a zinc-binding motif related to the zinc finger domain. The gene product can bind DNA and can act as a transcriptional repressor. It is associated with the multimeric polycomb group protein complex. The gene product interacts with the polycomb group proteins BMI1, EDR1, and CBX4, and colocalizes with these proteins in large nuclear domains. It interacts with the CBX4 protein via its glycine-rich C-terminal domain. The gene maps to the HLA class II region, where it is contiguous with the RING finger genes FABGL and HKE4.

Product Categories/Family for anti-RING1 antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 51479192
• NCBI GeneID: 6015
• NCBI Accession #: NP_002922
• NCBI GenBank Nucleotide #: NM_002931
• UniProt Accession #: Q06587; Q5JP96; Q5SQW2; Q86V19; A8JZZ0
• Molecular Weight: 39,146 Da
• NCBI Official Full Name: E3 ubiquitin-protein ligase RING1
• NCBI Official Synonym Full Names: ring finger protein 1
• NCBI Official Symbol: RING1
• NCBI Official Synonym Symbols: RNF1; RING1A
• NCBI Protein Information: E3 ubiquitin-protein ligase RING1; polycomb complex protein RING1; really interesting new gene 1 protein
• UniProt Protein Name: E3 ubiquitin-protein ligase RING1
• Protein Family: RING1 and YY1-binding protein
• UniProt Gene Name: RING1
• UniProt Synonym Gene Names: RNF1
• UniProt Entry Name: RING1_HUMAN

Uniprot Description

RING1: Constitutes one of the E3 ubiquitin-protein ligases that mediate monoubiquitination of 'Lys-119' of histone H2A, thereby playing a central role in histone code and gene regulation. H2A 'Lys-119' ubiquitination gives a specific tag for epigenetic transcriptional repression and participates in X chromosome inactivation of female mammals. Essential component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, rendering chromatin heritably changed in its expressibility. Compared to RNF2/RING2, it does not have the main E3 ubiquitin ligase activity on histone H2A, and it may rather act as a modulator of RNF2/RING2 activity. Component of chromatin-associated Polycomb (PcG) complexes. Interacts with BMI1. Part of the E2F6.com-1 complex in G0 phase composed of E2F6, MGA, MAX, TFDP1, CBX3, BAT8, EUHMTASE1, RING1, RNF2/RING2 MBLR, L3MBTL2 and YAF2. Interacts with CBX2 and PCGF6. Component of a PRC1-like complex. Component of repressive BCOR complex containing Polycomb group subcomplex at least composed of RYBP, PCGF1, BCOR and RNF2/RING2. Interacts with PCGF2, RNF2; CBX6, CBX7 and CBX8. Interacts with PHC2. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Ligase; Transcription factor; EC 6.3.2.-; EC 6.3.2.19; Ubiquitin conjugating system; Ubiquitin ligase

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: nucleoplasm; sex chromatin; cytoplasm; nuclear speck; PcG protein complex; nucleus

Molecular Function: protein binding; zinc ion binding; ubiquitin-protein ligase activity; chromatin binding; ligase activity

Biological Process: anterior/posterior pattern formation; camera-type eye morphogenesis; transcription, DNA-dependent; negative regulation of transcription, DNA-dependent