Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Mouse anti-Human RHOG Monoclonal Antibody | anti-RHOG antibody

RHOG (Rho-related GTP-binding Protein RhoG, ARHG) (HRP)

Gene Names
RHOG; ARHG
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RHOG; Monoclonal Antibody; RHOG (Rho-related GTP-binding Protein RhoG; ARHG) (HRP); anti-RHOG antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E6
Specificity
Recognizes human RHOG.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-RHOG antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa94-191 from RHOG (NP_001656) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RHKWHPEVCHHCPDVPILLVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPTPIKRGRSCILL
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Testing Data

(Detection limit for recombinant GST tagged RHOG is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RHOG is ~1ng/ml as a capture antibody.)
Related Product Information for anti-RHOG antibody
Required for the formation of membrane ruffles during macropinocytosis. Required for the formation of cup-like structures during trans-endothelial migration of leukocytes. In case of Salmonella enterica infection, activated by SopB and ARHGEF26/SGEF, which induces cytoskeleton rearrangements and promotes bacterial entry.
Product Categories/Family for anti-RHOG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
391
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 21 kDa

Observed: 23 kDa
NCBI Official Full Name
rho-related GTP-binding protein RhoG
NCBI Official Synonym Full Names
ras homolog family member G
NCBI Official Symbol
RHOG
NCBI Official Synonym Symbols
ARHG
NCBI Protein Information
rho-related GTP-binding protein RhoG; ras homolog gene family, member G (rho G)
UniProt Protein Name
Rho-related GTP-binding protein RhoG
UniProt Gene Name
RHOG
UniProt Synonym Gene Names
ARHG
UniProt Entry Name
RHOG_HUMAN

NCBI Description

This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The encoded protein facilitates translocation of a functional guanine nucleotide exchange factor (GEF) complex from the cytoplasm to the plasma membrane where ras-related C3 botulinum toxin substrate 1 is activated to promote lamellipodium formation and cell migration. Two related pseudogene have been identified on chromosomes 20 and X. [provided by RefSeq, Aug 2011]

Uniprot Description

RHOG: Required for the formation of membrane ruffles during macropinocytosis. Plays a role in cell migration and is required for the formation of cup-like structures during trans-endothelial migration of leukocytes. In case of Salmonella enterica infection, activated by SopB and ARHGEF26/SGEF, which induces cytoskeleton rearrangements and promotes bacterial entry. Belongs to the small GTPase superfamily. Rho family.

Protein type: G protein, monomeric; Motility/polarity/chemotaxis; G protein, monomeric, Rho

Chromosomal Location of Human Ortholog: 11p15.5-p15.4

Cellular Component: focal adhesion; plasma membrane; cytosol

Molecular Function: GTPase activity; protein binding; GTP binding

Biological Process: axon guidance; platelet activation; regulation of small GTPase mediated signal transduction; metabolic process; small GTPase mediated signal transduction; positive regulation of transcription, DNA-dependent; positive regulation of cell proliferation; Rac protein signal transduction; actin cytoskeleton organization and biogenesis; blood coagulation; Rho protein signal transduction

Research Articles on RHOG

Similar Products

Product Notes

The RHOG rhog (Catalog #AAA6154633) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RHOG (Rho-related GTP-binding Protein RhoG, ARHG) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RHOG can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RHOG rhog for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RHOG, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.