Mouse anti-Human RHOG Monoclonal Antibody | anti-RHOG antibody

RHOG (Rho-related GTP-binding Protein RhoG, ARHG) (Biotin)

Cat. Num. AAA6144027

• Gene Names: RHOG; ARHG
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RHOG; Monoclonal Antibody; RHOG (Rho-related GTP-binding Protein RhoG; ARHG) (Biotin); anti-RHOG antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2E6
• Specificity: Recognizes human RHOG.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-RHOG antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa94-191 from RHOG (NP_001656) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RHKWHPEVCHHCPDVPILLVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPTPIKRGRSCILL
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.52kD).)

Testing Data

(Detection limit for recombinant GST tagged RHOG is ~1ng/ml as a capture antibody.)

Related Product Information for anti-RHOG antibody

Required for the formation of membrane ruffles during macropinocytosis. Required for the formation of cup-like structures during trans-endothelial migration of leukocytes. In case of Salmonella enterica infection, activated by SopB and ARHGEF26/SGEF, which induces cytoskeleton rearrangements and promotes bacterial entry.

Product Categories/Family for anti-RHOG antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 46249393
• NCBI GeneID: 391
• NCBI Accession #: NP_001656
• NCBI GenBank Nucleotide #: NM_001665
• UniProt Accession #: P84095; P35238; Q8NI04
• Molecular Weight: Predicted: 21 kDa; ; Observed: 23 kDa
• NCBI Official Full Name: rho-related GTP-binding protein RhoG
• NCBI Official Synonym Full Names: ras homolog family member G
• NCBI Official Symbol: RHOG
• NCBI Official Synonym Symbols: ARHG
• NCBI Protein Information: rho-related GTP-binding protein RhoG; ras homolog gene family, member G (rho G)
• UniProt Protein Name: Rho-related GTP-binding protein RhoG
• Protein Family: Rho-related GTP-binding protein
• UniProt Gene Name: RHOG
• UniProt Synonym Gene Names: ARHG
• UniProt Entry Name: RHOG_HUMAN

NCBI Description

This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The encoded protein facilitates translocation of a functional guanine nucleotide exchange factor (GEF) complex from the cytoplasm to the plasma membrane where ras-related C3 botulinum toxin substrate 1 is activated to promote lamellipodium formation and cell migration. Two related pseudogene have been identified on chromosomes 20 and X. [provided by RefSeq, Aug 2011]

Uniprot Description

RHOG: Required for the formation of membrane ruffles during macropinocytosis. Plays a role in cell migration and is required for the formation of cup-like structures during trans-endothelial migration of leukocytes. In case of Salmonella enterica infection, activated by SopB and ARHGEF26/SGEF, which induces cytoskeleton rearrangements and promotes bacterial entry. Belongs to the small GTPase superfamily. Rho family.

Protein type: G protein, monomeric; Motility/polarity/chemotaxis; G protein, monomeric, Rho

Chromosomal Location of Human Ortholog: 11p15.5-p15.4

Cellular Component: focal adhesion; plasma membrane; cytosol

Molecular Function: GTPase activity; protein binding; GTP binding

Biological Process: axon guidance; platelet activation; regulation of small GTPase mediated signal transduction; metabolic process; small GTPase mediated signal transduction; positive regulation of transcription, DNA-dependent; positive regulation of cell proliferation; Rac protein signal transduction; actin cytoskeleton organization and biogenesis; blood coagulation; Rho protein signal transduction