Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human RHOBTB3 Monoclonal Antibody | anti-RHOBTB3 antibody

RHOBTB3 (Rho-related BTB Domain-containing Protein 3, KIAA0878) (MaxLight 490)

Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RHOBTB3; Monoclonal Antibody; RHOBTB3 (Rho-related BTB Domain-containing Protein 3; KIAA0878) (MaxLight 490); anti-RHOBTB3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3A10
Specificity
Recognizes human RHOBTB3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-RHOBTB3 antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from RHOBTB3 (NP_055714) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSIHIVALGNEGDTFHQDNRPSGLIRTYLGRSPLVSGDESSLLLNAASTVARPVFTEYQASAFGNVKLVVHDCPVWDIFDSDWYTSRNLIGGADIIVIK*
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-RHOBTB3 antibody
RHOBTB3 is a member of the evolutionarily conserved RHOBTB subfamily of Rho GTPases.
Product Categories/Family for anti-RHOBTB3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67kDa
NCBI Official Full Name
rho-related BTB domain-containing protein 3
NCBI Official Synonym Full Names
Rho related BTB domain containing 3
NCBI Official Symbol
RHOBTB3
NCBI Protein Information
rho-related BTB domain-containing protein 3
UniProt Protein Name
Rho-related BTB domain-containing protein 3
UniProt Gene Name
RHOBTB3
UniProt Synonym Gene Names
KIAA0878
UniProt Entry Name
RHBT3_HUMAN

NCBI Description

RHOBTB3 is a member of the evolutionarily conserved RHOBTB subfamily of Rho GTPases. For background information on RHOBTBs, see RHOBTB1 (MIM 607351).[supplied by OMIM, Apr 2004]

Uniprot Description

RHOBTB3: Rab9-regulated ATPase required for endosome to Golgi transport. Involved in transport vesicle docking at the Golgi complex, possibly by participating in release M6PRBP1/TIP47 from vesicles to permit their efficient docking and fusion at the Golgi. Specifically binds Rab9, but not other Rab proteins. Has low intrinsic ATPase activity due to autoinhibition, which is relieved by Rab9.

Protein type: EC 3.6.1.-; Hydrolase

Chromosomal Location of Human Ortholog: 5q15

Cellular Component: Golgi apparatus

Molecular Function: protein binding; GTP binding; ATPase activity; ATP binding; Rab GTPase binding

Biological Process: metabolic process; small GTPase mediated signal transduction; retrograde transport, endosome to Golgi

Research Articles on RHOBTB3

Similar Products

Product Notes

The RHOBTB3 rhobtb3 (Catalog #AAA6202958) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RHOBTB3 (Rho-related BTB Domain-containing Protein 3, KIAA0878) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RHOBTB3 can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RHOBTB3 rhobtb3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RHOBTB3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.