Mouse anti-Human RHOBTB3 Monoclonal Antibody | anti-RHOBTB3 antibody

RHOBTB3 (Rho-related BTB Domain-containing Protein 3, KIAA0878) (Biotin)

Cat. Num. AAA6144025

• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RHOBTB3; Monoclonal Antibody; RHOBTB3 (Rho-related BTB Domain-containing Protein 3; KIAA0878) (Biotin); anti-RHOBTB3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3A10
• Specificity: Recognizes human RHOBTB3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-RHOBTB3 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-100 from RHOBTB3 (NP_055714) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSIHIVALGNEGDTFHQDNRPSGLIRTYLGRSPLVSGDESSLLLNAASTVARPVFTEYQASAFGNVKLVVHDCPVWDIFDSDWYTSRNLIGGADIIVIK*
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged RHOBTB3 is 0.1ng/ml as a capture antibody.)

Related Product Information for anti-RHOBTB3 antibody

RHOBTB3 is a member of the evolutionarily conserved RHOBTB subfamily of Rho GTPases.

Product Categories/Family for anti-RHOBTB3 antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 115430108
• NCBI GeneID: 22836
• NCBI Accession #: NP_055714
• NCBI GenBank Nucleotide #: NM_014899
• UniProt Accession #: O94955
• Molecular Weight: 67kDa
• NCBI Official Full Name: rho-related BTB domain-containing protein 3
• NCBI Official Synonym Full Names: Rho related BTB domain containing 3
• NCBI Official Symbol: RHOBTB3
• NCBI Protein Information: rho-related BTB domain-containing protein 3
• UniProt Protein Name: Rho-related BTB domain-containing protein 3
• Protein Family: Rho-related BTB domain-containing protein
• UniProt Gene Name: RHOBTB3
• UniProt Synonym Gene Names: KIAA0878
• UniProt Entry Name: RHBT3_HUMAN

NCBI Description

RHOBTB3 is a member of the evolutionarily conserved RHOBTB subfamily of Rho GTPases. For background information on RHOBTBs, see RHOBTB1 (MIM 607351).[supplied by OMIM, Apr 2004]

Uniprot Description

RHOBTB3: Rab9-regulated ATPase required for endosome to Golgi transport. Involved in transport vesicle docking at the Golgi complex, possibly by participating in release M6PRBP1/TIP47 from vesicles to permit their efficient docking and fusion at the Golgi. Specifically binds Rab9, but not other Rab proteins. Has low intrinsic ATPase activity due to autoinhibition, which is relieved by Rab9.

Protein type: EC 3.6.1.-; Hydrolase

Chromosomal Location of Human Ortholog: 5q15

Cellular Component: Golgi apparatus

Molecular Function: protein binding; GTP binding; ATPase activity; ATP binding; Rab GTPase binding

Biological Process: metabolic process; small GTPase mediated signal transduction; retrograde transport, endosome to Golgi