Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged RHOBTB2 is 0.1ng/ml as a capture antibody.)

Mouse anti-Human RHOBTB2 Monoclonal Antibody | anti-RHOBTB2 antibody

RHOBTB2 (DBC2, KIAA0717, Rho-related BTB Domain-containing Protein 2, Deleted in Breast Cancer 2 Gene Protein, p83)

Gene Names
RHOBTB2; DBC2
Reactivity
Human
Applications
ELISA
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
RHOBTB2; Monoclonal Antibody; RHOBTB2 (DBC2; KIAA0717; Rho-related BTB Domain-containing Protein 2; Deleted in Breast Cancer 2 Gene Protein; p83); Anti -RHOBTB2 (DBC2; anti-RHOBTB2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G6
Specificity
Recognizes human RHOBTB2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
TISAHKPLLISSCDWMAAMFGGPFVESSTREVVFPYTSKSCMRAVLEYLYTGMFTSSPDLDDMKLIILANRLCLPHLVALTEQYTVTGLMEATQMMVDIDGDVLVFLELA
Applicable Applications for anti-RHOBTB2 antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Partial recombinant corresponding to aa510-619 from RHOBTB2 (AAH34917) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged RHOBTB2 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RHOBTB2 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-RHOBTB2 antibody
RHOBTB2 is a member of the evolutionarily conserved RHOBTB subfamily of Rho GTPases. For background information on RHOBTBs, see RHOBTB1 (MIM 607351).
Product Categories/Family for anti-RHOBTB2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82,626 Da
NCBI Official Full Name
rho-related BTB domain-containing protein 2 isoform 3
NCBI Official Synonym Full Names
Rho-related BTB domain containing 2
NCBI Official Symbol
RHOBTB2
NCBI Official Synonym Symbols
DBC2
NCBI Protein Information
rho-related BTB domain-containing protein 2; p83; deleted in breast cancer 2 gene protein
UniProt Protein Name
Rho-related BTB domain-containing protein 2
UniProt Gene Name
RHOBTB2
UniProt Synonym Gene Names
DBC2; KIAA0717
UniProt Entry Name
RHBT2_HUMAN

NCBI Description

The protein encoded by this gene is a small Rho GTPase and a candidate tumor suppressor. The encoded protein interacts with the cullin-3 protein, a ubiquitin E3 ligase necessary for mitotic cell division. This protein inhibits the growth and spread of some types of breast cancer. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]

Uniprot Description

RHOBTB2: is a small Rho GTPase and a candidate tumor suppressor. The encoded protein interacts with the cullin-3 protein, a ubiquitin E3 ligase necessary for mitotic cell division. This protein inhibits the growth and spread of some types of breast cancer. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]

Protein type: G protein; G protein, monomeric; G protein, monomeric, Rho

Chromosomal Location of Human Ortholog: 8p21.3

Cellular Component: plasma membrane; cytosol

Molecular Function: GTP binding

Biological Process: regulation of small GTPase mediated signal transduction; small GTPase mediated signal transduction

Research Articles on RHOBTB2

Similar Products

Product Notes

The RHOBTB2 rhobtb2 (Catalog #AAA645419) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RHOBTB2 (DBC2, KIAA0717, Rho-related BTB Domain-containing Protein 2, Deleted in Breast Cancer 2 Gene Protein, p83) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RHOBTB2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the RHOBTB2 rhobtb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TISAHKPLLI SSCDWMAAMF GGPFVESSTR EVVFPYTSKS CMRAVLEYLY TGMFTSSPDL DDMKLIILAN RLCLPHLVAL TEQYTVTGLM EATQMMVDID GDVLVFLELA. It is sometimes possible for the material contained within the vial of "RHOBTB2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.