Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: HSD3B6Sample Tissue: Mouse Testis lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse HSD3B2 Polyclonal Antibody | anti-HSD3B2 antibody

HSD3B2 Antibody - middle region

Gene Names
Hsd3b2; Hsd3b1; Hsd3b6; Hsd3b2l1
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
HSD3B2; Polyclonal Antibody; HSD3B2 Antibody - middle region; anti-HSD3B2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GPNSYKKIILNGHEEEHHESTWSNPYPYSKKMAEKAVLAANGSILKNGGT
Sequence Length
373
Applicable Applications for anti-HSD3B2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle terminal region of mouse HSD3B6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: HSD3B6Sample Tissue: Mouse Testis lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: HSD3B6Sample Tissue: Mouse Testis lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-HSD3B2 antibody
enzyme responsible for the production of progesterone as well as the precursors of androgens, estrogens, glucocorticoids and mineralcorticoids [RGD, Feb 2006]
Product Categories/Family for anti-HSD3B2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42 kDa
NCBI Official Full Name
3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 4
NCBI Official Synonym Full Names
hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2
NCBI Official Symbol
Hsd3b2
NCBI Official Synonym Symbols
Hsd3b1; Hsd3b6; Hsd3b2l1
NCBI Protein Information
3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 4
UniProt Protein Name
3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 6
UniProt Gene Name
Hsd3b6
UniProt Synonym Gene Names
3-beta-HSD VI
UniProt Entry Name
3BHS6_MOUSE

NCBI Description

enzyme responsible for the production of progesterone as well as the precursors of androgens, estrogens, glucocorticoids and mineralcorticoids [RGD, Feb 2006]

Uniprot Description

Hsd3b6:

Protein type: EC 5.3.3.1; EC 1.1.1.145

Cellular Component: endoplasmic reticulum; integral to membrane; membrane; mitochondrial inner membrane; mitochondrial intermembrane space; mitochondrion

Molecular Function: (R)-2-hydroxyglutarate dehydrogenase activity; (R)-2-hydroxyisocaproate dehydrogenase activity; 2-hydroxytetrahydrofuran dehydrogenase activity; 3-beta-hydroxy-delta5-steroid dehydrogenase activity; 3-ketoglucose-reductase activity; 5-exo-hydroxycamphor dehydrogenase activity; acetoin dehydrogenase activity; aldo-keto reductase activity; arabinose reductase activity; C-3 sterol dehydrogenase (C-4 sterol decarboxylase) activity; catalytic activity; D-arabinitol dehydrogenase (NADP+) activity; epoxide dehydrogenase activity; gluconate dehydrogenase activity; isocitrate dehydrogenase activity; isomerase activity; mevaldate reductase activity; oxidoreductase activity; oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor; phenylcoumaran benzylic ether reductase activity; steroid dehydrogenase activity; steroid dehydrogenase activity, acting on the CH-CH group of donors; steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor; steroid delta-isomerase activity; xylose reductase activity

Biological Process: metabolic process; steroid biosynthetic process

Research Articles on HSD3B2

Similar Products

Product Notes

The HSD3B2 hsd3b6 (Catalog #AAA3223762) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HSD3B2 Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's HSD3B2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HSD3B2 hsd3b6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GPNSYKKIIL NGHEEEHHES TWSNPYPYSK KMAEKAVLAA NGSILKNGGT. It is sometimes possible for the material contained within the vial of "HSD3B2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.