Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human RGN Monoclonal Antibody | anti-RGN antibody

RGN (Regucalcin, RC, Senescence Marker Protein 30, SMP-30, SMP30) (HRP)

Gene Names
RGN; RC; GNL; SMP30; HEL-S-41
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RGN; Monoclonal Antibody; RGN (Regucalcin; RC; Senescence Marker Protein 30; SMP-30; SMP30) (HRP); anti-RGN antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4B9
Specificity
Recognizes human RGN.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
1637
Applicable Applications for anti-RGN antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa200-300 from RGN (NP_004674) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EQIPDGMCIDAEGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGGIFKITGLGVKGIAPYSYAG
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of RGN expression in transfected 293T cell line by RGN monoclonal antibody Lane 1: RGN transfected lysate (33.3kD). Lane 2: Non-transfected lysate. )

Western Blot (WB) (Western Blot analysis of RGN expression in transfected 293T cell line by RGN monoclonal antibody Lane 1: RGN transfected lysate (33.3kD). Lane 2: Non-transfected lysate. )
Related Product Information for anti-RGN antibody
RGN is a highly conserved, calcium-binding protein, that is preferentially expressed in the liver and kidney. This protein may have an important role in calcium homeostasis. Studies in rat indicate that the protein may also play a role in aging, as it shows age-associated down-regulation.
Product Categories/Family for anti-RGN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens regucalcin (RGN), transcript variant 1, mRNA
NCBI Official Synonym Full Names
regucalcin
NCBI Official Symbol
RGN
NCBI Official Synonym Symbols
RC; GNL; SMP30; HEL-S-41
NCBI Protein Information
regucalcin
UniProt Protein Name
Regucalcin
Protein Family
UniProt Gene Name
RGN
UniProt Synonym Gene Names
SMP30; RC; GNL; SMP-30
UniProt Entry Name
RGN_HUMAN

NCBI Description

The protein encoded by this gene is a highly conserved, calcium-binding protein, that is preferentially expressed in the liver and kidney. It may have an important role in calcium homeostasis. Studies in rat indicate that this protein may also play a role in aging, as it shows age-associated down-regulation. This gene is part of a gene cluster on chromosome Xp11.3-Xp11.23. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]

Uniprot Description

RGN: Gluconolactonase with low activity towards other sugar lactones, including gulonolactone and galactonolactone. Can also hydrolyze diisopropyl phosphorofluoridate and phenylacetate (in vitro). Calcium-binding protein. Modulates Ca(2+) signaling, and Ca(2+)-dependent cellular processes and enzyme activities. Belongs to the SMP-30/CGR1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.1.1.17

Chromosomal Location of Human Ortholog: Xp11.3

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: zinc ion binding; gluconolactonase activity; calcium ion binding; enzyme regulator activity

Biological Process: cellular calcium ion homeostasis; L-ascorbic acid biosynthetic process; positive regulation of ATPase activity; regulation of calcium-mediated signaling

Research Articles on RGN

Similar Products

Product Notes

The RGN rgn (Catalog #AAA6154616) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RGN (Regucalcin, RC, Senescence Marker Protein 30, SMP-30, SMP30) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RGN can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RGN rgn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RGN, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.