Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-LTA4H Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: U937 cell lysate)

Rabbit LTA4H Polyclonal Antibody | anti-LTA4H antibody

LTA4H antibody - N-terminal region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LTA4H; Polyclonal Antibody; LTA4H antibody - N-terminal region; anti-LTA4H antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQDT
Sequence Length
611
Applicable Applications for anti-LTA4H antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human LTA4H
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-LTA4H Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: U937 cell lysate)

Western Blot (WB) (WB Suggested Anti-LTA4H Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: U937 cell lysate)
Related Product Information for anti-LTA4H antibody
This is a rabbit polyclonal antibody against LTA4H. It was validated on Western Blot

Target Description: LTA4H hydrolyzes an epoxide moiety of leukotriene A4 (LTA-4) to form leukotriene B4 (LTB-4). The enzyme also has some peptidase activity.
Product Categories/Family for anti-LTA4H antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69kDa
NCBI Official Full Name
leukotriene A-4 hydrolase isoform 1
NCBI Official Synonym Full Names
leukotriene A4 hydrolase
NCBI Official Symbol
LTA4H
NCBI Protein Information
leukotriene A-4 hydrolase
UniProt Protein Name
Leukotriene A-4 hydrolase
Protein Family
UniProt Gene Name
LTA4H
UniProt Synonym Gene Names
LTA4; LTA-4 hydrolase
UniProt Entry Name
LKHA4_HUMAN

NCBI Description

The protein encoded by this gene is an enzyme that contains both hydrolase and aminopeptidase activities. The hydrolase activity is used in the final step of the biosynthesis of leukotriene B4, a proinflammatory mediator. The aminopeptidase activity has been shown to degrade proline-glycine-proline (PGP), a neutrophil chemoattractant and biomarker for chronic obstructive pulmonary disease (COPD). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2015]

Uniprot Description

LTA4H: Epoxide hydrolase that catalyzes the final step in the biosynthesis of the proinflammatory mediator leukotriene B4. Has also aminopeptidase activity. Belongs to the peptidase M1 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.3.2.6; Hydrolase; Lipid Metabolism - arachidonic acid

Chromosomal Location of Human Ortholog: 12q22

Cellular Component: nucleoplasm; cytoplasm; cytosol

Molecular Function: peptidase activity; leukotriene-A4 hydrolase activity; metallopeptidase activity; zinc ion binding; epoxide hydrolase activity; aminopeptidase activity

Biological Process: leukotriene biosynthetic process; peptide catabolic process; arachidonic acid metabolic process; leukotriene metabolic process; proteolysis; inflammatory response

Research Articles on LTA4H

Similar Products

Product Notes

The LTA4H lta4h (Catalog #AAA3211628) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LTA4H antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LTA4H can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LTA4H lta4h for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IVIEISFETS PKSSALQWLT PEQTSGKEHP YLFSQCQAIH CRAILPCQDT. It is sometimes possible for the material contained within the vial of "LTA4H, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.