Mouse anti-Human RGCC Monoclonal Antibody | anti-Rgcc antibody

RGCC (C13orf15, RGC32, Regulator of Cell Cycle RGCC, Response Gene to Complement 32 Protein)

Cat. Num. AAA6013335

• Gene Names: Rgcc; Rgc32; Rgc-32; 1190002H23Rik
• Reactivity: Human
• Applications: ELISA
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: RGCC; Monoclonal Antibody; RGCC (C13orf15; RGC32; Regulator of Cell Cycle RGCC; Response Gene to Complement 32 Protein); Anti -RGCC (C13orf15; anti-Rgcc antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3B9
• Specificity: Recognizes human C13orf15.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MKPPAEDLSDALCEFDAVLADFASPFHERHFHYEEHLERMKRRSSASVSDSSGFSDSESADSLYRNSFSFSDEKLNSPTDSTPALLSATVTPQKAKLGDTKELEAFIADLDKTLASM*

• Applicable Applications for anti-Rgcc antibody: ELISA (EL/EIA)
• Application Notes: Suitable for use in ELISA.
• Immunogen: Partial recombinant corresponding to aa1-118 from human RGCC (NP_054778) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit is 0.03ng/ml using MBS6013335 as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of C13orf15 on HeLa cells using MBS6013335 (10ug/ml).)

Related Product Information for anti-Rgcc antibody

C13orf15 is thought to regulate cell cycle progression. It is induced by p53 in response to DNA damage, or by sublytic levels of complement system proteins that result in activation of the cell cycle. The encoded protein localizes to the cytoplasm during interphase and to centrosomes during mitosis. The protein forms a complex with polo-like kinase 1. The protein also translocates to the nucleus in response to treatment with complement system proteins, and can associate with and increase the kinase activity of cell division cycle 2 protein. In different assays and cell types, overexpression of this protein has been shown to activate or suppress cell cycle progression.

Product Categories/Family for anti-Rgcc antibody

Antibodies; Abs to Complement

NCBI and Uniprot Product Information

• NCBI GI #: 127138620
• NCBI GeneID: 66214
• NCBI Accession #: NP_079703.2
• NCBI GenBank Nucleotide #: NM_025427.2
• UniProt Accession #: Q9DBX1; Q9D0U0
• Molecular Weight: 14,717 Da
• NCBI Official Full Name: regulator of cell cycle RGCC
• NCBI Official Synonym Full Names: regulator of cell cycle
• NCBI Official Symbol: Rgcc
• NCBI Official Synonym Symbols: Rgc32; Rgc-32; 1190002H23Rik
• NCBI Protein Information: regulator of cell cycle RGCC; response gene to complement 32 protein
• UniProt Protein Name: Regulator of cell cycle RGCC
• Protein Family: Regulator of cell cycle
• UniProt Gene Name: Rgcc
• UniProt Synonym Gene Names: Rgc32; RGC-32
• UniProt Entry Name: RGCC_MOUSE

Uniprot Description

RGC32: modulates the activity of cell cycle-specific kinases. Interacts with CDK1 and PLK1. Enhances CDK1 activity and contribute to the regulation of the cell cycle. May inhibit growth of glioma cells by promoting arrest of mitotic progression at the G2/M transition. Fibrogenic factor contributing to the pathogenesis of renal fibrosis through fibroblast activation. Interacts with SMAD3. Cytoplasmic in unstimulated cells; translocates to the nucleus following activation by complement. Associated with the centrosome during prometaphase and metaphase. Induced by Epstein-Barr virus (EBV). Up-regulated in aorta endothelial cells in response to complement activation. Important in vascular smooth muscle cell (VSMC) differentiation following transforming growth factor-beta (TGF-beta) induction. Its expression is greatly induced by TGF-beta in neural crest cells, leading to the induction of VSMC gene promoters. Smad and RhoA signaling are important for RGC-32 activation in neural crest cells. Forms a complex with hnRNP A/B that regulates the transcription of VSMC differentiation genes. Two isoforms of the human protein are produced by alternative splicing.

Protein type: Protein kinase, regulatory subunit; Cell cycle regulation

Cellular Component: centrosome; cytoskeleton; cytoplasm; nucleus

Molecular Function: protein binding; protein kinase binding; protein kinase activator activity

Biological Process: positive regulation of mitosis; regulation of cell cycle; negative regulation of cytokine secretion; positive regulation of collagen biosynthetic process; negative regulation of blood vessel endothelial cell migration; cell cycle; G1/S-specific positive regulation of cyclin-dependent protein kinase activity; complement activation; negative regulation of cell proliferation; negative regulation of angiogenesis; negative regulation of exit from mitosis; positive regulation of stress fiber formation; negative regulation of endothelial cell proliferation; positive regulation of transcription factor activity; positive regulation of transcription from RNA polymerase II promoter; positive regulation of cytokine secretion; G1/S transition of mitotic cell cycle