Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit is 0.03ng/ml using MBS6013335 as a capture antibody.)

Mouse anti-Human RGCC Monoclonal Antibody | anti-RGCC antibody

RGCC (C13orf15, RGC32, Regulator of Cell Cycle RGCC, Response Gene to Complement 32 Protein) APC

Gene Names
RGCC; RGC32; RGC-32; C13orf15; bA157L14.2
Reactivity
Human
Applications
Immunofluorescence
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RGCC; Monoclonal Antibody; RGCC (C13orf15; RGC32; Regulator of Cell Cycle RGCC; Response Gene to Complement 32 Protein) APC; anti-RGCC antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3B9
Specificity
Recognizes human RGCC.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-RGCC antibody
FLISA, Immunofluorescence (IF)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa1-117 from human RGCC with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MKPPAEDLSDALCEFDAVLADFASPFHERHFHYEEHLERMKRRSSASVSDSSGFSDSESADSLYRNSFSFSDEKLNSPTDSTPALLSATVTPQKAKLGDTKELEAFIADLDKTLASM*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit is 0.03ng/ml using MBS6013335 as a capture antibody.)

Testing Data (Detection limit is 0.03ng/ml using MBS6013335 as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of C13orf15 on HeLa cells using MBS6013335 (10ug/ml).)

Immunofluorescence (IF) (Immunofluorescence of C13orf15 on HeLa cells using MBS6013335 (10ug/ml).)
Related Product Information for anti-RGCC antibody
C13orf15 is thought to regulate cell cycle progression. It is induced by p53 in response to DNA damage, or by sublytic levels of complement system proteins that result in activation of the cell cycle. The encoded protein localizes to the cytoplasm during interphase and to centrosomes during mitosis. The protein forms a complex with polo-like kinase 1. The protein also translocates to the nucleus in response to treatment with complement system proteins, and can associate with and increase the kinase activity of cell division cycle 2 protein. In different assays and cell types, overexpression of this protein has been shown to activate or suppress cell cycle progression.
Product Categories/Family for anti-RGCC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15kDa
NCBI Official Full Name
regulator of cell cycle RGCC
NCBI Official Synonym Full Names
regulator of cell cycle
NCBI Official Symbol
RGCC
NCBI Official Synonym Symbols
RGC32; RGC-32; C13orf15; bA157L14.2
NCBI Protein Information
regulator of cell cycle RGCC
UniProt Protein Name
Regulator of cell cycle RGCC
Protein Family
UniProt Gene Name
RGCC
UniProt Synonym Gene Names
C13orf15; RGC32; RGC-32

NCBI Description

This gene is thought to regulate cell cycle progression. It is induced by p53 in response to DNA damage, or by sublytic levels of complement system proteins that result in activation of the cell cycle. The encoded protein localizes to the cytoplasm during interphase and to centrosomes during mitosis. The protein forms a complex with polo-like kinase 1. The protein also translocates to the nucleus in response to treatment with complement system proteins, and can associate with and increase the kinase activity of cell division cycle 2 protein. In different assays and cell types, overexpression of this protein has been shown to activate or suppress cell cycle progression. [provided by RefSeq, Jul 2008]

Uniprot Description

Modulates the activity of cell cycle-specific kinases. Enhances CDK1 activity. May contribute to the regulation of the cell cycle. May inhibit growth of glioma cells by promoting arrest of mitotic progression at the G2/M transition. Fibrogenic factor contributing to the pathogenesis of renal fibrosis through fibroblast activation.

Research Articles on RGCC

Similar Products

Product Notes

The RGCC rgcc (Catalog #AAA6138704) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RGCC (C13orf15, RGC32, Regulator of Cell Cycle RGCC, Response Gene to Complement 32 Protein) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RGCC can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RGCC rgcc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RGCC, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.