Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.57kD).)

Mouse anti-Human Resistin Monoclonal Antibody | anti-RSTN antibody

Resistin (RETN, RSTN, Adipose Tissue-specific Secretory Factor, ADSF, C/EBP-epsilon-regulated Myeloid-specific Secreted Cysteine-rich Protein, Cysteine-rich Secreted Protein A12-alpha-like 2, Cysteine-rich Secreted Protein FIZZ3, FIZZ3, HXCP1, RETN1, XCP1

Gene Names
RETN; ADSF; RSTN; XCP1; FIZZ3; RETN1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Resistin; Monoclonal Antibody; Resistin (RETN; RSTN; Adipose Tissue-specific Secretory Factor; ADSF; C/EBP-epsilon-regulated Myeloid-specific Secreted Cysteine-rich Protein; Cysteine-rich Secreted Protein A12-alpha-like 2; Cysteine-rich Secreted Protein FIZZ3; FIZZ3; HXCP1; RETN1; XCP1; MGC126603; MGC126609; anti-RSTN antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
5E8
Specificity
Recognizes human RETN.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-RSTN antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa20-106 from human RETN (NP_065148) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRV
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.57kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.57kD).)
Product Categories/Family for anti-RSTN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34.3 kDa (303aa)
NCBI Official Full Name
resistin
NCBI Official Synonym Full Names
resistin
NCBI Official Symbol
RETN
NCBI Official Synonym Symbols
ADSF; RSTN; XCP1; FIZZ3; RETN1
NCBI Protein Information
resistin
UniProt Protein Name
Resistin
Protein Family
UniProt Gene Name
RETN
UniProt Synonym Gene Names
FIZZ3; HXCP1; RSTN; ADSF
UniProt Entry Name
RETN_HUMAN

NCBI Description

This gene belongs to the family defined by the mouse resistin-like genes. The characteristic feature of this family is the C-terminal stretch of 10 cys residues with identical spacing. The mouse homolog of this protein is secreted by adipocytes, and may be the hormone potentially linking obesity to type II diabetes. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2010]

Uniprot Description

resistin: Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes. Belongs to the resistin/FIZZ family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: extracellular space; nucleus

Molecular Function: hormone activity

Biological Process: fat cell differentiation; response to mechanical stimulus; positive regulation of smooth muscle cell proliferation; positive regulation of smooth muscle cell migration; positive regulation of synaptic transmission; response to insulin stimulus; aging

Disease: Diabetes Mellitus, Noninsulin-dependent

Research Articles on RSTN

Similar Products

Product Notes

The RSTN retn (Catalog #AAA6149297) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Resistin (RETN, RSTN, Adipose Tissue-specific Secretory Factor, ADSF, C/EBP-epsilon-regulated Myeloid-specific Secreted Cysteine-rich Protein, Cysteine-rich Secreted Protein A12-alpha-like 2, Cysteine-rich Secreted Protein FIZZ3, FIZZ3, HXCP1, RETN1, XCP1 reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Resistin can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RSTN retn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Resistin, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.