Mouse RBP7 Monoclonal Antibody | anti-RBP7 antibody

RBP7 (Retinol Binding Protein 7, Cellular, CRBP4, CRBPIV, MGC70641) (HRP)

Cat. Num. AAA6182922

• Gene Names: RBP7; CRBP4; CRBPIV
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: RBP7; Monoclonal Antibody; RBP7 (Retinol Binding Protein 7; Cellular; CRBP4; CRBPIV; MGC70641) (HRP); Retinol Binding Protein 7; MGC70641; anti-RBP7 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4F4
• Specificity: Recognizes RBP7.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-RBP7 antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: RBP7 (NP_443192.1, 35aa-134aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged RBP7 is 1 ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of RBP7 expression in transfected 293T cell line by RBP7 monoclonal antibody (M01), clone 4F4.Lane 1: RBP7 transfected lysate (Predicted MW: 15.5 KDa).Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RBP7 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RBP7 on HeLa cell. [antibody concentration 10 ug/ml])

Product Categories/Family for anti-RBP7 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 16418455
• NCBI GeneID: 116362
• NCBI Accession #: NP_443192.1
• NCBI GenBank Nucleotide #: NM_052960.2
• UniProt Accession #: Q96R05; Q5SWJ4; B2R517
• Molecular Weight: 15,536 Da
• NCBI Official Full Name: retinoid-binding protein 7
• NCBI Official Synonym Full Names: retinol binding protein 7, cellular
• NCBI Official Symbol: RBP7
• NCBI Official Synonym Symbols: CRBP4; CRBPIV
• NCBI Protein Information: retinoid-binding protein 7; CRABP-IV; CRABP4; cellular retinoic acid-binding protein 4; cellular retinoic acid-binding protein IV; putative cellular retinol-binding protein CRBP IV; retinoid binding protein 7
• UniProt Protein Name: Retinoid-binding protein 7
• Protein Family: Retinoid-binding protein
• UniProt Gene Name: RBP7
• UniProt Synonym Gene Names: CRABP4; CRBP4; CRABP-IV
• UniProt Entry Name: RET7_HUMAN

NCBI Description

Due to its chemical instability and low solubility in aqueous solution, vitamin A requires cellular retinol-binding proteins (CRBPs), such as RBP7, for stability, internalization, intercellular transfer, homeostasis, and metabolism.[supplied by OMIM, May 2004]

Uniprot Description

RBP7: Intracellular transport of retinol. Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

Chromosomal Location of Human Ortholog: 1p36.22

Cellular Component: cytoplasm

Molecular Function: transporter activity; retinol binding; retinal binding

Biological Process: transport