Mouse anti-Human RBM3 Monoclonal Antibody | anti-RBM3 antibody

RBM3 (Putative RNA-binding Protein 3, RNA-binding Motif Protein 3, RNPL) (AP)

Cat. Num. AAA6133353

• Gene Names: RBM3; RNPL; IS1-RNPL
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RBM3; Monoclonal Antibody; RBM3 (Putative RNA-binding Protein 3; RNA-binding Motif Protein 3; RNPL) (AP); anti-RBM3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4D6
• Specificity: Recognizes human RBM3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-RBM3 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-81, from human RBM3 (NP_006734) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVD
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to RBM3 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged RBM3 is 0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-RBM3 antibody

Antibodies; RNA Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 5803137
• NCBI GeneID: 5935
• NCBI Accession #: NP_006734
• NCBI GenBank Nucleotide #: NM_006743
• UniProt Accession #: P98179
• Molecular Weight: 19 kDa (180aa) confirmed by MALDI-TOF
• NCBI Official Full Name: RNA-binding protein 3
• NCBI Official Synonym Full Names: RNA binding motif protein 3
• NCBI Official Symbol: RBM3
• NCBI Official Synonym Symbols: RNPL; IS1-RNPL
• NCBI Protein Information: RNA-binding protein 3
• UniProt Protein Name: RNA-binding protein 3
• Protein Family: RNA-binding protein
• UniProt Gene Name: RBM3
• UniProt Synonym Gene Names: RNPL
• UniProt Entry Name: RBM3_HUMAN

NCBI Description

This gene is a member of the glycine-rich RNA-binding protein family and encodes a protein with one RNA recognition motif (RRM) domain. Expression of this gene is induced by cold shock and low oxygen tension. A pseudogene exists on chromosome 1. Multiple alternatively spliced transcript variants that are predicted to encode different isoforms have been characterized although some of these variants fit nonsense-mediated decay (NMD) criteria. [provided by RefSeq, Jul 2008]

Uniprot Description

RBM3: Cold-inducible mRNA binding protein that enhances global protein synthesis at both physiological and mild hypothermic temperatures. Reduces the relative abundance of microRNAs, when overexpressed. Enhances phosphorylation of translation initiation factors and active polysome formation.

Protein type: Ribosomal; Translation; RNA-binding; RNA processing

Chromosomal Location of Human Ortholog: Xp11.2

Cellular Component: cytoplasm; dendrite; nucleus; large ribosomal subunit

Molecular Function: protein binding; RNA binding; nucleotide binding; ribosomal large subunit binding

Biological Process: RNA processing; regulation of translation; miRNA-mediated gene silencing, production of miRNAs; positive regulation of translation; translation; response to cold