Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to RBM3 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3ug/ml])

Mouse anti-Human RBM3 Monoclonal Antibody | anti-RBM3 antibody

RBM3 (Putative RNA-binding Protein 3, RNA-binding Motif Protein 3, RNPL) (AP)

Gene Names
RBM3; RNPL; IS1-RNPL
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RBM3; Monoclonal Antibody; RBM3 (Putative RNA-binding Protein 3; RNA-binding Motif Protein 3; RNPL) (AP); anti-RBM3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4D6
Specificity
Recognizes human RBM3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-RBM3 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-81, from human RBM3 (NP_006734) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVD
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to RBM3 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3ug/ml])

Testing Data (Immunoperoxidase of monoclonal antibody to RBM3 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged RBM3 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RBM3 is 0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-RBM3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19 kDa (180aa) confirmed by MALDI-TOF
NCBI Official Full Name
RNA-binding protein 3
NCBI Official Synonym Full Names
RNA binding motif protein 3
NCBI Official Symbol
RBM3
NCBI Official Synonym Symbols
RNPL; IS1-RNPL
NCBI Protein Information
RNA-binding protein 3
UniProt Protein Name
RNA-binding protein 3
Protein Family
UniProt Gene Name
RBM3
UniProt Synonym Gene Names
RNPL
UniProt Entry Name
RBM3_HUMAN

NCBI Description

This gene is a member of the glycine-rich RNA-binding protein family and encodes a protein with one RNA recognition motif (RRM) domain. Expression of this gene is induced by cold shock and low oxygen tension. A pseudogene exists on chromosome 1. Multiple alternatively spliced transcript variants that are predicted to encode different isoforms have been characterized although some of these variants fit nonsense-mediated decay (NMD) criteria. [provided by RefSeq, Jul 2008]

Uniprot Description

RBM3: Cold-inducible mRNA binding protein that enhances global protein synthesis at both physiological and mild hypothermic temperatures. Reduces the relative abundance of microRNAs, when overexpressed. Enhances phosphorylation of translation initiation factors and active polysome formation.

Protein type: Ribosomal; Translation; RNA-binding; RNA processing

Chromosomal Location of Human Ortholog: Xp11.2

Cellular Component: cytoplasm; dendrite; nucleus; large ribosomal subunit

Molecular Function: protein binding; RNA binding; nucleotide binding; ribosomal large subunit binding

Biological Process: RNA processing; regulation of translation; miRNA-mediated gene silencing, production of miRNAs; positive regulation of translation; translation; response to cold

Research Articles on RBM3

Similar Products

Product Notes

The RBM3 rbm3 (Catalog #AAA6133353) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RBM3 (Putative RNA-binding Protein 3, RNA-binding Motif Protein 3, RNPL) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RBM3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RBM3 rbm3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RBM3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.