Mouse RBL2 Monoclonal Antibody | anti-RBL2 antibody

RBL2 (Retinoblastoma-like 2 (p130), FLJ26459, P130, Rb2) (HRP)

Cat. Num. AAA6181504

• Gene Names: RBL2; Rb2; P130
• Applications: ELISA
• Purity: Purified
• Synonyms: RBL2; Monoclonal Antibody; RBL2 (Retinoblastoma-like 2 (p130); FLJ26459; P130; Rb2) (HRP); Retinoblastoma-like 2 (p130); Rb2; anti-RBL2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4D7
• Specificity: Recognizes RBL2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-RBL2 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: RBL2 (NP_005602, 416aa-515aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VTPVSTATHSLSRLHTMLTGLRNAPSEKLEQILRTCSRDPTQAIANRLKEMFEIYSQHFQPDEDFSNCAKEIASKHFRFAEMLYYKVLESVIEQEQKRLG
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged RBL2 is 0.3 ng/ml as a capture antibody.)

Product Categories/Family for anti-RBL2 antibody

Antibodies; Retinoblastoma Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 172072597
• NCBI GeneID: 5934
• NCBI Accession #: NP_005602
• NCBI GenBank Nucleotide #: NM_005611.3
• UniProt Accession #: Q08999; Q15073; Q16084; Q8NE70; Q92812; B7Z913
• Molecular Weight: 59,349 Da
• NCBI Official Full Name: retinoblastoma-like protein 2 isoform 1
• NCBI Official Synonym Full Names: RB transcriptional corepressor like 2
• NCBI Official Symbol: RBL2
• NCBI Official Synonym Symbols: Rb2; P130
• NCBI Protein Information: retinoblastoma-like protein 2
• UniProt Protein Name: Retinoblastoma-like protein 2
• Protein Family: RHOMBOID-like protein
• UniProt Gene Name: RBL2
• UniProt Synonym Gene Names: RB2; p130; RBR-2
• UniProt Entry Name: RBL2_HUMAN

Uniprot Description

Rb-like 2: Key regulator of entry into cell division. Directly involved in heterochromatin formation by maintaining overall chromatin structure and, in particular, that of constitutive heterochromatin by stabilizing histone methylation. Recruits and targets histone methyltransferases SUV420H1 and SUV420H2, leading to epigenetic transcriptional repression. Controls histone H4 'Lys-20' trimethylation. Probably acts as a transcription repressor by recruiting chromatin-modifying enzymes to promoters. Potent inhibitor of E2F-mediated trans-activation, associates preferentially with E2F5. Binds to cyclins A and E. Binds to and may be involved in the transforming capacity of the adenovirus E1A protein. May act as a tumor suppressor. Belongs to the retinoblastoma protein (RB) family.

Protein type: Tumor suppressor; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 16q12.2

Cellular Component: nucleoplasm; transcription factor complex; cytoplasm; nucleolus; nucleus

Molecular Function: protein binding; DNA binding

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription, DNA-dependent; regulation of cell cycle; mitotic cell cycle; regulation of lipid kinase activity; chromatin modification