Mouse anti-Human SAFB Monoclonal Antibody | anti-SAFB antibody

SAFB (Scaffold Attachment Factor B1, SAF-B, SAF-B1, HSP27 Estrogen Response Element-TATA Box-binding Protein, HSP27 ERE-TATA-binding Protein, HAP, HET, SAFB1, DKFZp779C1727) APC

Cat. Num. AAA6138899

• Gene Names: SAFB; HAP; HET; SAFB1; SAF-B1
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SAFB; Monoclonal Antibody; SAFB (Scaffold Attachment Factor B1; SAF-B; SAF-B1; HSP27 Estrogen Response Element-TATA Box-binding Protein; HSP27 ERE-TATA-binding Protein; HAP; HET; SAFB1; DKFZp779C1727) APC; anti-SAFB antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 5A11
• Specificity: Recognizes human SAFB.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-SAFB antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa111-201 from human SAFB (NP_002958) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DGQEDVETSLENLQDIDIMDISVLDEAEIDNGSVADCVEDDDADNLQESLSDSRELVEGEMKELPEQLQEHAIEDKETINNLDTSSSDFT*
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.01kD).)

Western Blot (WB)

(SAFB monoclonal antibody, Western Blot analysis of SAFB expression in Hela NE.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SAFB on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SAFB on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged SAFB is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-SAFB antibody

Antibodies; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 21264343
• NCBI GeneID: 6294
• NCBI Accession #: NP_002958
• NCBI GenBank Nucleotide #: NM_002967
• UniProt Accession #: Q15424; O60406; Q59HH8; A0AV56; B7Z5B6; B7ZLP6; F5H0H3
• Molecular Weight: 102,768 Da
• NCBI Official Full Name: scaffold attachment factor B1 isoform 3
• NCBI Official Synonym Full Names: scaffold attachment factor B
• NCBI Official Symbol: SAFB
• NCBI Official Synonym Symbols: HAP; HET; SAFB1; SAF-B1
• NCBI Protein Information: scaffold attachment factor B1; HSP27 ERE-TATA-binding protein; HSP27 estrogen response element-TATA box-binding protein; Hsp27 ERE-TATA binding protein; SAB-B1; SAF-B; glutathione S-transferase fusion protein; heat-shock protein (HSP27) estrogen response
• UniProt Protein Name: Scaffold attachment factor B1
• Protein Family: Scaffold attachment factor
• UniProt Gene Name: SAFB
• UniProt Synonym Gene Names: HAP; HET; SAFB1; SAF-B; SAF-B1; HSP27 ERE-TATA-binding protein

Uniprot Description

Binds to scaffold/matrix attachment region (S/MAR) DNA and forms a molecular assembly point to allow the formation of a 'transcriptosomal' complex (consisting of SR proteins and RNA polymerase II) coupling transcription and RNA processing (). Can function as an estrogen receptor corepressor and can also bind to the HSP27 promoter and decrease its transcription. When associated with RBMX, binds to and stimulates transcription from the SREBF1 promoter (). Can inhibit cell proliferation.